KEGG   Spinacia oleracea (spinach): 110798992Help
Entry
110798992         CDS       T05137                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 2, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
soe  Spinacia oleracea (spinach)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:soe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110798992
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110798992
Enzymes [BR:soe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110798992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 180 aa AA seqDB search
MASSVLSSAAVATVSRTPAQASMVAPFTGLKSTVGFPATKKNDDITSLASNGGRVQCMKV
WPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETEHGFVYREHHNSPGYYD
GRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPEGY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgtcctctcctccgccgctgtcgccaccgtcagccgtaccccggctcaa
gccagcatggtggctcctttcaccggcttgaagtctaccgtaggcttccctgccaccaag
aagaacgatgacattacctcccttgctagcaacggtggaagagtccagtgcatgaaggta
tggccaacacaaaacatgaagaggtacgagactctatcgtaccttccacctcttaccaca
gatcagttggcgcggcaggtcgattaccttcttaacaataaatgggttccttgcttagaa
ttcgagactgaacatggatttgtataccgtgagcaccacaattccccagggtactatgac
ggtcgttactggacaatgtggaagttgccgatgttcgggtgcactgacccggcccaggtt
ttgaatgagctcgaagaatgcaagaaggagtaccccaacgccttcatccgtatcattgga
ttcgacagcaaccgtcaagtccaatgtgtcagtttcattgcctacaagcctgaaggctac
taa

DBGET integrated database retrieval system