KEGG   Streptococcus cristatus: I872_01640Help
Entry
I872_01640        CDS       T02649                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
soi  Streptococcus cristatus
Pathway
soi00473  D-Alanine metabolism
soi01100  Metabolic pathways
soi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:soi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    I872_01640 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    I872_01640 (alr)
Enzymes [BR:soi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     I872_01640 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:soi01011]
 Precursor biosynthesis
  Racemase
   I872_01640 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: AGK70447
UniProt: N0C4B8
LinkDB All DBs
Position
342741..343847
Genome map
AA seq 368 aa AA seqDB search
MKASLHRPTKAVIDLSAIAFNIEQIAAHIPQSVQKWAVVKANAYGHGAIPVSQHVQGLVD
GFCVSNIDEALELREAGIAKPILILGVSSLEAVPLAIQQQITLTVASLAWLEELLSQQPN
LTGLTVHIKIDSGMGRIGFRDSQEAQQAISRLQAAGAVVEGIFTHFATADERDASHFVAQ
LSRFKEILSGLAFLPPIVHASNSATTLWHSETIMNAVRLGDIIYGLNPSGRVLDLPYEVK
PALSLESALVHVKEIQAGAHVGYGATYTSDSLQIIGTIPLGYADGWTRDMQGFDVLIDGQ
RCPIVGRVSMDQITVRLPQVYPLGTQVVLIGNSGAELITATDVADKRGTINYEVVCLISD
RVPREYKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctagtctacatagacccactaaagcagtcatagacttgtctgctattgcattt
aatattgagcaaattgcggctcatattccccagtcggtccagaagtgggcagtagtcaag
gctaatgcttatggacatggtgcaattcctgtctctcaacacgttcagggccttgtagac
ggtttttgcgtatcaaatattgacgaagctctcgaactacgagaagctggcattgctaaa
ccaattcttattttgggtgtttcttcactagaggctgtgcctttagcgatccagcagcag
attaccttgacggtggccagtctagcttggctggaggaactcttgagccagcaacctaat
ctgacgggcttgactgttcatatcaagattgattcaggcatgggacgcattggcttccgt
gatagtcaagaagcccagcaagcaattagccgcctgcaagcagcaggagctgtggtagaa
gggattttcactcattttgcaactgctgatgaaagagatgcgagtcattttgtagcccaa
ttaagtcgctttaaagagattttgagtgggttagctttcttgccgccgattgtgcatgct
agtaactctgccacaactctctggcatagtgaaacgattatgaatgctgttcggctgggt
gatattatttacggtctgaatcctagcggacgagtgctggatttgccttatgaggttaaa
ccagctttgagtttagaatctgccttggttcacgtcaaagaaattcaagcgggcgcccat
gtcggctatggggcgacctataccagtgatagcctgcaaatcattggtaccattcctttg
ggttatgctgatggctggacccgagatatgcagggctttgatgttttgattgatggtcag
cgctgcccaattgtcggtcgggtttcaatggatcagatcacggtgcgtctgcctcaagtc
taccctttgggaacgcaggtggttttgattggtaatagtggcgccgagcttatcacagcg
acggatgtggcggacaaacgtggtacgattaactatgaagtggtctgcttaatcagtgac
agggtaccgagagagtataaaaagtaa

DBGET integrated database retrieval system