KEGG   Solanum tuberosum (potato): 102578684Help
Entry
102578684         CDS       T02981                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUVR5
Organism
sot  Solanum tuberosum (potato)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1509 aa AA seqDB search
MEVLPCSNIHYVPESDCPQQGSGTTLMYGGKPNHLEHAEQVQAGDVKVDDVLLNTQECQE
EKADGRQFSVEGLPTADRIPTKDAYYDFGGDSQMLSSDFHDSGDDNVVEHDHVTRSDLVP
ECLRPVVDTIEIGLPYSNQVVGSSSCESKWLDEDGPLAVWVKWRGLWQAGIRCARADWPL
STLKAKPTHERKKYLVIFFPRTRNYSWADVLLVRPISEFPHPIAYKTHKVGVKTVKDLTL
GHRFIMQRLAISILNIIDQLHAEALEETARSVMVWKEFAMEVSRCKGYPDLGRMLLKFND
MILPLYKKSFSMESWIQHCQNANSAETIEMLKEELADSILWDELNSLPNEGLHLDLNSQW
KNCKSEVMKWFSVSHPVSDSGDVEQPNNDSPLKMELQQSRKRPKLEVRRAETHALPVEFQ
VSHQAVPVGFDAGVLGGHDISKNVLLEYELTKDDISLREAPPSGSPGSVADRWGEIIVQA
DNSDVIQMKDVELTPINGVVSSNSFDHGSKNRQCMAFIESKGRQCVRWANDGDVYCCVHL
ASRFASSSIRMDASPHVETPMCGGTTVLGTKCKHRALCGSPFCKKHRPRDEKGLGSILPE
SKHKRKHEDNVLRLDTSSCKDIVLAGAFDAPLQVDPISVLRGESFYRNNLLEVPQYLQNR
PSGSEMHCIGLWPHGSELCVESPKRHSLYCEKHLPSWLKRARNGRSRIISKEVFIELLKD
CQSRDQRLYLHQACELFYRLLKSLLSLRNPVPKEVQFQWVISEASKDPMVGEFLMKLVCT
EKERLKSVWGFSSTENAQASSYIEEPIPLLRITDNDQDHCDVIKCKICSETFPDEQVLGT
HWLDNHKKEAQWLFRGYACAICLDSFTNKKVLETHVQERHHSQFVENCMLFQCIPCTSNF
GNSEELWSHVLTAHPASFRWSHTAQENHFPASEVVSEKPDIGYSLSTQNFNSENQSGFRK
FICRFCGLKFDLLPDLGRHHQAAHMGPNPVGSHISKKGIHLYAHKLKSGRLSRPKFKKGI
GSVAYRIRNRNAQNMKKHILSSNSIISGKSTIQPSATEAAGLGRLADPHCLDIAKILFAE
IKRTKPRPSNSDILSIARITCCKVSLQASLEATYGILPERMYLKAAKLCSEHNILVSWHQ
DGFICPKGCRPVHDPFIVSSLLPLPGQANRTGSIPPNSAISEWTMDECHYVIDSQQFKHE
PSDKTILLCDDISFGQESVPITCVVEENLFASLHILADGSNGQITTSSLPWESFTYATKS
LIDQSVDLAIGSSQLGCACPNSACSSQTCDHIYLFDNDYEDAKDIYGKPMRGRFPYDERG
RIMLEEGYLVYECNQWCSCSKSCQNRVLQSGVRVKLEIYKTETRGWAVRAREAILRGTFV
CEYVGEVLDEQEANKRRNRYATEGCGYFLEIDAYINDMSRLIEGQSPYVIDATNYGNISR
YINHSCSPNLVNYQVLVESMEHQLAHVGFYARRDILAGEELTYDYRYKLLPGEGSPCLCG
SSNCRGRLY
NT seq 4530 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgctcccatgttccaatatacattatgtcccggagtctgattgccctcaacaa
ggctctggaactactcttatgtatggtggaaaaccaaaccaccttgaacatgcagaacaa
gttcaagccggtgatgtgaaagtcgatgatgtccttcttaatacgcaggagtgtcaggaa
gagaaagcagatggacgtcaattctctgtcgagggattaccaacagcagataggattcct
actaaagatgcatattatgattttgggggagatagccaaatgctatccagtgatttccat
gattctggagatgacaatgttgtggaacatgatcatgttacaagatctgatctagtgcca
gagtgcctgcgaccagttgttgacactattgaaattggactcccttatagtaaccaggtt
gtgggatcctcttcctgcgagtccaagtggctggatgaagatggacctctagctgtatgg
gtcaagtggagggggttgtggcaagcaggaattagatgtgcaagagctgattggccgctg
tcgactctcaaagctaagcctacgcatgagaggaaaaaatatcttgtgatattctttcct
cgcaccagaaattattcttgggctgatgtgcttcttgttcgcccaattagtgaattccca
catcccatcgcatataaaacccataaagttggggtgaaaacggtgaaagacttgactctt
ggtcaccggtttatcatgcaaagacttgctatcagcatactgaatattattgatcaatta
catgccgaggctctagaagagactgctcgcagtgtgatggtatggaaggaatttgcaatg
gaggtttcccgctgcaagggctatcctgatcttggaaggatgcttttgaaatttaatgat
atgatactgccgttgtataaaaaatcattttcgatggagtcttggattcagcactgtcag
aatgccaacagtgctgagacaattgaaatgctgaaggaggaattggctgattctatactt
tgggatgagttgaactcacttccaaatgaaggattacatcttgatctgaactctcagtgg
aagaattgcaaatctgaggttatgaaatggttttcagtttcacatcccgtatctgatagt
ggagatgttgaacagccgaataatgacagcccattgaaaatggagcttcagcagagcaga
aagaggcccaagcttgaagttcgtcgtgctgagacacatgctttgccagtggaatttcag
gtgtcacatcaggctgtccctgttggatttgatgctggtgttcttggtggccatgatatt
tccaaaaatgtactgttagaatatgaactaacaaaagatgacatttctcttagagaggct
cctccaagtggttctcctggtagtgtggcagatagatggggagagattattgttcaagca
gacaattctgacgtcattcagatgaaagatgtggaactgacccctataaatggagttgtt
tcaagtaattcctttgatcatggaagtaaaaatcgccagtgtatggcttttattgaatcc
aaaggaagacaatgtgtcagatgggcaaatgatggtgatgtttattgttgtgtgcacttg
gcctctcgctttgccagtagctcaattaggatggatgcatctccacatgttgaaacacct
atgtgtggagggaccactgttcttgggactaaatgtaaacatcgcgccttatgcggctct
cctttctgtaagaaacacaggccccgagatgagaaaggattgggttctattttgcctgag
agtaaacataaacgaaagcatgaggacaatgtccttagattggatacctcaagttgcaaa
gatattgttctcgctggagcatttgatgctccgctccaagttgatcctatctcagttctt
cgtggagaatctttctataggaacaacttgcttgaggtgcctcagtatttgcagaacaga
cctagtggttctgagatgcattgcattggtttgtggccacatggaagtgagctttgcgta
gaaagtccaaaacgacattcattatactgtgagaagcatttaccaagctggcttaaacgt
gcgaggaatggcaggagtaggataatttcaaaggaagtattcatagaacttttgaaggat
tgccagtccagggatcaaagattgtatttacatcaagcttgtgagcttttctatagactt
ctcaaaagtttactttctttgagaaacccagttccaaaagaagtgcaattccaatgggtc
atatctgaagcttctaaagatccaatggttggtgaattcttaatgaaattagtttgtact
gaaaaagagaggctgaagagtgtttggggctttagctctactgaaaatgcacaagcttcc
tcttacatcgaagagccaattccattattaaggattacggataatgaccaggatcattgt
gatgtcataaagtgcaaaatttgctcagagacgtttccagatgagcaagtgcttggcacg
cactggttggacaaccacaaaaaggaagctcaatggctgttcaggggttatgcttgtgct
atctgcctggattcttttactaataagaaagttttggaaactcatgtgcaggaaaggcac
cattcacagtttgttgaaaattgcatgcttttccagtgtattccgtgtactagcaatttt
gggaactcagaggagttatggtcccacgtgctcaccgcacatcctgccagttttagatgg
tctcatactgctcaagaaaatcattttcctgcaagtgaggttgtgtcagagaagcctgat
ataggctactccttgtcgacacagaatttcaattcagagaaccagtctggtttccgaaaa
ttcatctgcagattttgtggcctgaaatttgacttgctacctgatctaggccgccatcat
caggctgctcacatgggtcctaatcctgttggctctcatatctccaagaagggcatccat
ttatatgctcataaattgaagtcaggaagacttagccgtccgaaattcaagaagggtatc
ggctctgtagcatataggattaggaacagaaatgctcagaatatgaagaaacacatcctg
tcatcaaactccattattagtggaaaatctacgattcaacctagtgcaaccgaggcagct
ggtctaggtcgactggcagatccccactgcttagatattgcaaagatattgtttgctgag
attaagagaacaaagccacggccaagtaactcagacatcttatcaatagctcggattact
tgctgcaaagtaagcctccaagcatcacttgaagcaacatatggaattttgccagagcgc
atgtatctcaaagcagcaaaattgtgtagtgagcacaatatccttgtaagctggcaccaa
gatggtttcatttgccccaaaggatgtagacctgttcatgatcctttcatagtatcttca
ttacttccccttcctggtcaagcgaatagaactggaagtattccaccaaattctgctatt
agtgagtggactatggatgaatgtcactatgtcattgattctcaacagttcaagcatgaa
ccatccgacaaaactattctcttgtgtgatgacataagctttggacaggagtcagttccg
ataacttgtgtggtagaagaaaatctttttgcctccctccacattcttgctgatggctcc
aatggccaaattaccacaagttctctaccttgggagagctttacctatgcaacaaaatca
ttgattgatcaatccgtggatcttgctatagggagttcccaattggggtgtgcttgtcca
aattcagcatgctcttctcaaacttgtgatcatatttacctttttgataatgattacgag
gatgcaaaggatatttatgggaagcctatgcgtggaaggttcccatatgatgagagaggt
cggattatgttggaggagggctaccttgtctatgaatgcaatcaatggtgctcgtgcagt
aaatcttgtcagaatagggttttacagagtggagtgcgtgtgaagctagaaatatacaaa
accgagacaaggggatgggcagtcagggcaagagaagcaatccttcgtggtacatttgtg
tgtgaatatgtaggagaggtacttgatgagcaggaagcaaataaaagacgcaataggtat
gccacagaaggttgtgggtacttcttggagatagatgcttacatcaatgatatgagcaga
ctgattgaagggcagtctccatatgtaatcgatgctactaactatggaaacatttcccgt
tatatcaaccacagttgctcaccaaatctcgtgaattaccaagttctcgtggaaagcatg
gaacatcagcttgcacatgttggtttttatgcaaggcgagatatacttgcaggtgaagaa
ctgacctatgattatagatacaaactattgcccggagaagggtctccatgcctgtgtggc
tcctccaattgcaggggacgtctttactaa

DBGET integrated database retrieval system