KEGG   Solanum tuberosum (potato): 102594980Help
Entry
102594980         CDS       T02981                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sot  Solanum tuberosum (potato)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102594980
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102594980
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102594980
   00430 Taurine and hypotaurine metabolism
    102594980
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    102594980
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    102594980
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102594980
Enzymes [BR:sot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102594980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 497 aa AA seqDB search
MVISKAASESDLSVHSTFASRYVRVSLPRFKMPENSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGEGEAAIG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPHDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFIYPEIEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNIMENCQENTRVLREGLEK
TERFNIVSKEIGVPLVAFSLKDNSRHNEFEISEHLRRFGWIVPAYTMPANAEHVTVLRVV
IREDFSRTLAERLVADIEKVLHELDTLPARVTAKLAATAEGEGSSGHKKSPMEVQLEITN
VWKKFVAEKKKTKNVIC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtcatatccaaggccgcctcggagtccgatctctctgtccactccacctttgcttca
cgctatgttcgcgtttctcttccccggtttaagatgccggagaattcgataccaaaggac
gcagcatatcaaataataaatgatgaattaatgttggatggaaatccaaggctaaattta
gcttcatttgtcacaacatggatggaaccagaatgtgataagctaatcatggattcaatt
aacaagaactatgttgacatggatgaataccctgtcaccactgagcttcagaatcgatgt
gtaaacatgatagcccatttatttaatgcaccattgggagagggagaggctgctattgga
gttggaactgttggatcctcagaagccattatgcttgctggattagcctttaagagaaaa
tggcaaaacaaaatgaaggcccaaggaaagccccatgacaagcccaatattgttactggg
gccaatgtccaggtatgctgggagaaatttgcaaggtacttcgaagtagaattaaaagaa
gtgaaattagaggatggatactatgtgatggaccctgagaaagctgtggaaatggttgat
gaaaacactatttgtgttgctgctattttgggttccacacttaatggagaatttgaagat
gtcaaacgtttgaatgatctcttggttgagaagaacaaagaaactgggtgggatactcca
attcatgtggatgcagcaagtggtggatttattgccccatttatctatccagaaattgaa
tgggattttagattaccattagttaaaagtattaatgtaagtggtcacaaatatggtctt
gtttatgctggtattggttgggttatttggaggaacaaagaagatttgcctgaagagctt
attttccacatcaattatcttggtgctgatcaacctactttcacccttaacttctctaaa
ggttctagtcaagtaattgcacaatattatcaacttattcgcttaggttatgaggggtac
aagaatattatggagaattgtcaagaaaatacaagggtactaagagaaggacttgaaaag
acagaaagattcaacatagtttccaaagaaattggagtcccattagtagcattctctctc
aaagacaatagtagacacaacgaattcgagatttctgaacaccttaggaggtttgggtgg
atcgtgccagcttacacgatgccagccaatgctgagcacgttaccgtgctcagggtagtg
attcgggaagatttttcccgaacactagctgagaggctcgtggcggatattgaaaaagtc
ctccatgagctcgacaccctccctgccagagtcacggctaaattggccgcgaccgcggag
ggtgaaggctcatcagggcataagaaatccccaatggaagtgcaattggaaatcaccaat
gtatggaagaagtttgttgctgaaaaaaagaagaccaaaaatgtaatatgttaa

DBGET integrated database retrieval system