KEGG   Solanum tuberosum (potato): 102596222Help
Entry
102596222         CDS       T02981                                 

Definition
(RefSeq) histone deacetylase 9
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102596222
Chromosome [BR:sot03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102596222
   HDAC complexes
    Sin3A-HDAC complex
     102596222
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102596222
  Chromatin remodeling factors
   NuRD complex
    102596222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 430 aa AA seqDB search
MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYGLHSKMEVYRPHKAYPVEL
AQFHSADYVEFLNRITPETQNLFPSEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
NNKLCDIAINWAGGLHHAKKCAASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKYGDKFFPGTGDMKDTGERDGRFYSINVPLKDGIDDGSFTRLFKT
IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY
TKENVARCWALETGVLLDTELPNEIPDNDYIKYFAPDYSLKLPGGHIENLNSKSYIGTIK
MQVMENLRCLQHAPSVQMQEVPPDFFIPDFDEDEQNPDERVNQHTQDKHIQRDDEYYEGD
HDNDNHTDDA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccaaggacaaaatctcctacttctacgacggtgatgttggaagcgtatacttt
ggtccgaatcatccaatgaagccgcacaggttgtgtatgactcatcatctggttctagca
tatggacttcacagcaagatggaagtttataggcctcacaaagcatatccagtggagcta
gcgcagtttcattctgctgattatgtagaattcttgaacagaataaccccagaaactcag
aacttgttccctagtgaaatggcaagatataatcttggagaagattgccctgtatttgac
aacttattcgagttttgtcaaatatatgctggtggaacaatagatgctgcacgtagattg
aataataagctttgtgatattgcaataaattgggctggtggattgcatcatgccaagaag
tgtgcggcttcaggattttgctatatcaatgacctagttctggggatattggagcttcta
aagtatcatccgcgggtgctctatattgatattgatgtgcatcacggtgatggtgtagaa
gaggccttttattttactgacagggttatgaccgttagtttccacaagtatggggataag
ttctttcctggaactggtgatatgaaggatacaggggaaagagatggaagattctattcc
ataaatgtgcctctcaaggatggaatagatgacggcagtttcactagactcttcaaaaca
attatttcaaaggttgttgaaacatatttacctggcgcaatagttctgcaatgtggggca
gattcgcttgctggagaccgtctgggctgcttcaacctctccattgatggacatgctgaa
tgtgtaaggtttgtgaagaaatttaatttgcctctgctggtaactggaggtgggggatac
acaaaagagaatgtcgcccgttgttgggctctggaaaccggagttcttttagacacagag
cttcctaatgaaataccagacaatgattacatcaaatattttgcccctgattattcactg
aagcttcctggtggacacatagagaacctgaatagcaaatcatacattggcaccataaaa
atgcaagtgatggaaaatctccgttgcctccagcatgctccgagcgtacagatgcaagag
gtaccacctgacttttttattcctgattttgatgaagatgaacaaaatccagatgagcgt
gtgaatcagcatacccaagataagcatatccaacgtgacgatgagtattatgaaggcgac
catgacaatgataaccacactgatgatgcctaa

DBGET integrated database retrieval system