KEGG   Solanum tuberosum (potato): 102605773Help
Entry
102605773         CDS       T02981                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
sot  Solanum tuberosum (potato)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102605773
   00051 Fructose and mannose metabolism
    102605773
   00052 Galactose metabolism
    102605773
   00500 Starch and sucrose metabolism
    102605773
   00520 Amino sugar and nucleotide sugar metabolism
    102605773
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102605773
Enzymes [BR:sot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102605773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 499 aa AA seqDB search
MGKLVVGVSVVCTAAVVCGVAVLLMKRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVA
DAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEK
RIVKHEVKEVSIPQNVMAGSSSEVLFDFIATALAEFVATEGDDFHLPPGRQRELGFTFSF
PVKQLSIASGTLIKWTKGFSIEDVVGQDVVGELAKAMERAGLDVRVAALVNDTVGTLAGG
RYNNPDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFLSSHLPVTEY
DQNLDVESLNPGEQIYEKMISGMYLGEILRRVLCRMAKEASLFGDYVPSKLKIPFILRTP
DMAAMHHDESADLKVVGNKLKDILEVPNSTLKMRKIVVELCDIITSRGARLSAAGIVGIL
KKLGKDTLKDGENQRSVIAVDGALFERYTKFRNCLEETMKELLGDTADSIVIELSNDGSG
VGAALLAASHSQYTDLEES
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattggttgtaggtgtatcagttgtgtgtactgctgctgtagtatgtggggtg
gcagttttgttaatgaagcgcaggatgaagaattctggggagtggggaaaagttgaagct
ttattgaaggattttgaggagaagtgtgcaactccaatggggaaacttaagcaggtagct
gatgctatgactgtagagatgcatgctggacttgcttctgaaggtgggagtaagctcaag
atgcttattagctatgttgataaccttcctactggggacgaagaaggtctgttttatgca
ttggatctaggcggcacaaactttcgtgtgatgcgtgtgcagttgggtgggaacgaaaag
cgtatagttaaacatgaagttaaagaagtttcaattccacagaatgtgatggctggatca
tcatctgaagtgttatttgattttattgccacggcacttgcagaatttgtagctacagaa
ggtgatgattttcatcttccacctggtagacaaagggaattaggctttaccttctctttc
cctgtgaaacaattgtcaattgcatcaggaactcttattaaatggacaaagggcttctcc
atagaagacgtggttggccaagatgtggtgggagaattagcaaaagcaatggaaagggcc
ggccttgatgtgcgtgtggctgctttagtcaatgatactgttggaacgttagcaggaggt
cggtacaataatcctgatgtcattgctgcagtaattttgggtactggaaccaatgcagca
tatgttgaacgggctcatgcgattcccaaatggcatggtctgttgccgaaatccggagag
atggttatcaacatggaatggggtaatttcctctcatcacatcttccagtaacagaatat
gaccaaaatcttgatgttgagagtttaaaccccggggagcagatttatgaaaagatgatc
tccgggatgtatcttggagaaattttgcgtagagtattgtgtagaatggctaaagaagct
tcattattcggtgattatgtcccatccaaactgaaaattcctttcatattgaggactccg
gatatggctgctatgcatcacgacgagtcggctgatctcaaggtggttggcaataaactg
aaggatatcttagaggtacctaattctaccttgaaaatgaggaaaatagttgtggagcta
tgcgacattatcacctctcgtggagctcgtctttctgcagcaggaatcgtgggcatcctc
aagaaattgggaaaagacactttgaaggacggagagaaccagaggtctgtcatagctgtg
gacggtgcattgtttgagcgttacaccaagttcagaaattgcttggaggaaactatgaaa
gagttactgggagacactgcggacagcatagtcattgagctttctaatgatggttcaggt
gttggagctgcacttttggctgcctcgcattcccaatacacagatctcgaggaatcatga

DBGET integrated database retrieval system