KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1506Help
Entry
M6_Spy1506        CDS       T00191                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00220  Arginine biosynthesis
spa00250  Alanine, aspartate and glutamate metabolism
spa00290  Valine, leucine and isoleucine biosynthesis
spa01100  Metabolic pathways
spa01110  Biosynthesis of secondary metabolites
spa01130  Biosynthesis of antibiotics
spa01210  2-Oxocarboxylic acid metabolism
spa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M6_Spy1506
   00290 Valine, leucine and isoleucine biosynthesis
    M6_Spy1506
   00220 Arginine biosynthesis
    M6_Spy1506
Enzymes [BR:spa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M6_Spy1506
    2.6.1.66  valine---pyruvate transaminase
     M6_Spy1506
Amino acid related enzymes [BR:spa01007]
 Aminotransferase (transaminase)
  Class I
   M6_Spy1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAT87641
UniProt: Q5XAC2
LinkDB All DBs
Position
complement(1497162..1498412)
Genome map
AA seq 416 aa AA seqDB search
MVYNMEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELI
SMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatggaatacgaggtgtatgagactatgaaaattattgaaaaatcatca
aaattagaacatgttgcctatgatattcgagggcctgttttggatgaagctaatcgcatg
attgcgagtggtgaaaaaattctgcgtttaaatactggcaatcctgctgcctttggtttt
gaagcaccagatgaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctat
tctgacagtaaagggattttttcagcacgtaaggctatcatgcagtattgccaactcaag
ggcttcccagatgttgacattgaagatatttatttgggaaatggcgtgtcagagttgata
tccatgtcccttcaagctttgctagataatggcgatgaagttttagtaccaatgccggat
tatcctttatggacggcttgtgtgagtcttggtggaggaaaagcagtccattatctttgt
gatgaagaagctggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaatcctaataacccaacaggagccctttatcctaaggag
attttagaagacatcgttgctttggcaagagaacaccagctgattatttttgccgatgaa
atctatgatcgtttggtgatggatggtaaagagcatattgctattgcaagtttggcacct
gatgttttttgtgtatctatgaatggcctttccaaatctcatcgtattgctggttttcgt
gttggatggatggtcttatcaggtcctaaagaccatgttaaaggttacattgaagggttg
aacatgcttgccaatatgcggttatgctccaatgttttagctcaacaagttgttcaaact
tccttaggaggccatcaatcagttgatgcactgttactgccaggagggcgtatttttgag
caacgtaattttatttatgaagctattaatgctatccctggcttatcggcagttaaacct
gaagcaggtctttatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgat
gaagaatttgtcttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggt
tttaactggaaagatccagatcacttccgtattgtttacctaccaagtgtagaagaatta
gaagatgttcaagaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system