KEGG   Spathaspora passalidarum: SPAPADRAFT_140568Help
Entry
SPAPADRAFT_140568 CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:spaa00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    SPAPADRAFT_140568
Enzymes [BR:spaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SPAPADRAFT_140568
Chromosome [BR:spaa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     SPAPADRAFT_140568
   HDAC complexes
    Sin3A-HDAC complex
     SPAPADRAFT_140568
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    SPAPADRAFT_140568
  Chromatin remodeling factors
   NuRD complex
    SPAPADRAFT_140568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18870300
NCBI-ProteinID: XP_007376586
JGI: 140568
UniProt: G3ARQ5
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MYVQLPFDELKVDPTQKKRIAYFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFISRVSPDNLELFAKEQIKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMSCSFHKYGEFFPGTGELRDIGVGKGKYHSVNVPLRDG
IDDATYKSIFEPLITKIVEWYQPSAIVLQCGGDSLSGDRLGCFNLSMSGHANCINFVKSF
NIPMMVLGGGGYTMRNVARTWAFESGLLNNVVLPSELPYNEYYEYYAPDYKLDVRPSNMY
NSNSPEFLDKILTNIISNLENTKHAPSVQMNVVPNDAEELGDVEEDTKEAMDTKGGSELA
RDAQIQPDNEFYEEDDKDKGEKNIDETTNGTSKLTDEEMNEIEKLNSE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttcaacttccatttgacgaattaaaagttgatccaacccagaaaaaacgtatt
gcatatttctatgatgccgatattgggaattacgcctatggagccggtcatcctatgaag
ccccatcgtattagaatggcacattctttgattatgaactatgggttatataagaagatg
gaaatctaccgagctaaaccagctaccaagcaggaaatgtgtcaatttcatacagatgaa
tatattgattttatatcgagggtttctcctgataatttagaattatttgctaaggagcag
attaagtttaatgtcggtgatgattgtcctgttttcgacggattgtttgaatattgtggg
attagtggaggtgggagtatggaaggtgcagctaggttaaaccgaggcaaatgtgacatt
gctataaattatgctggtggattacatcatgctaagaaatccgaagctagtgggttttgc
tatttaaatgatattgttcttggaataattgaattgttgagatatcatcctcgagtatta
tatattgatatagatgtccatcatggtgacggtgttgaagaagcattttatacaactgat
agagttatgtcatgttcattccataaatatggagaatttttccctggtactggagaatta
agagatatcggagttggtaaagggaagtatcatagtgttaatgttccacttcgagatggg
attgatgacgctacctataaatctatctttgaaccattaatcaccaagattgttgaatgg
taccaaccttcagctatagttttacaatgtggtggtgattccttgagtggagacagatta
ggatgttttaatttatcaatgtcgggacatgctaattgtattaattttgttaaatcgttt
aatatccctatgatggttcttggtggaggtggttatactatgagaaatgttgctagaact
tgggcattcgaatctggattgttgaataacgtcgtattgccttcagaattaccatacaat
gaatactatgaatactatgctccggattataagttagatgttagaccttctaatatgtat
aattcaaattcgccagagtttttggataagatattaaccaatatcatttcaaatttggag
aatacaaaacacgcaccaagtgttcaaatgaatgttgttcctaatgatgcagaagaatta
ggtgatgttgaagaagacactaaagaagcaatggacacaaaaggtggatctgaattagct
cgagatgcccaaattcaaccagacaatgaattttatgaagaagatgacaaagataagggg
gaaaagaatatagatgagaccaccaatggtacttcaaagttgacagacgaagagatgaat
gagattgagaagttgaacagtgagtag

DBGET integrated database retrieval system