KEGG   Sphingomonas panacis: AWL63_03400Help
Entry
AWL63_03400       CDS       T04760                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
span  Sphingomonas panacis
Pathway
span00010  Glycolysis / Gluconeogenesis
span00071  Fatty acid degradation
span00350  Tyrosine metabolism
span00625  Chloroalkane and chloroalkene degradation
span00626  Naphthalene degradation
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01120  Microbial metabolism in diverse environments
span01130  Biosynthesis of antibiotics
span01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:span00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWL63_03400
  Lipid metabolism
   00071 Fatty acid degradation
    AWL63_03400
  Amino acid metabolism
   00350 Tyrosine metabolism
    AWL63_03400
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AWL63_03400
   00626 Naphthalene degradation
    AWL63_03400
Enzymes [BR:span01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AWL63_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AOH83162
UniProt: A0A1B3Z6V5
LinkDB All DBs
Position
complement(750357..751388)
Genome map
AA seq 343 aa AA seqDB search
MEKTMKAAVVREFGKPLVIEEVAVRMPGPGQILVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCEDQQNTGYSV
NGSFAEYVIADPNYVGHLPANVGFVEIAPVLCAGVTVYKGLKVTDTKPGDWMAISGIGGL
GHMAVQYAKAMGLNVVAVDIDDAKLRLAEELGATLTVNARNTDPAAFIKKEIGGAQGVLV
TAVSPIAFAQAMGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLQEAL
DFAGDGKVRATVATDTLENINDIFGRMHRGEIEGRIVIDFEKG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacaatgaaagcggcggtcgtccgcgaattcggcaagcctctggtcatcgag
gaggtggccgtgcggatgccgggtccgggccagatcctcgtcaagatcgcggcgacgggt
gtgtgtcacaccgatctgcacgcggcggaaggcgactggccggtcaaacccaacccgccg
ttcattcccggccatgaaggcgtcggccatgtcgtcgcggtcggcgcgggcgtcacccat
gtcaaggaaggcgaccgcgtcggcgtgccgtggctctacaccgcctgcgggcattgcgtg
cattgcctcggcggctgggagacattgtgcgaggaccagcagaacaccggctattcggtc
aacggcagcttcgccgaatatgtcatcgccgatcccaattacgtcggacatctccccgcc
aacgtcggcttcgtcgagatcgcgccggtgctgtgcgcgggcgtgacggtctacaagggc
ctcaaggtcaccgacaccaagccgggggactggatggcgatctcgggcatcggcgggctg
ggccatatggcggtgcaatatgccaaggcgatgggattgaacgtcgtcgcggtcgatatc
gacgacgccaagctgcggctggccgaggagctcggcgcgacgctgacggtgaacgcgcgc
aacaccgatcccgccgcgttcatcaagaaggagatcggcggcgcgcagggcgtgctggtg
acggcggtctcgccgatcgccttcgcgcaggcgatgggtatggtgcgtcgcggcgggacg
gtcgcgctcaatggcctgccgccgggcgatttcccgctgtcgatcttcgataccgtgctc
aacggcatcaccgtgcgcggttcgatcgtgggaacacggctcgaccttcaggaagcgctc
gatttcgcgggtgacggcaaggtccgcgcgaccgtggccaccgatacgcttgagaatatc
aacgatatcttcgggcggatgcatcgcggcgagatcgagggacggatcgtgatcgacttc
gagaaagggtga

DBGET integrated database retrieval system