KEGG   Streptococcus pantholopis: A0O21_01275Help
Entry
A0O21_01275       CDS       T05054                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
spat  Streptococcus pantholopis
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:spat00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A0O21_01275
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A0O21_01275
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A0O21_01275
   00430 Taurine and hypotaurine metabolism
    A0O21_01275
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    A0O21_01275
Enzymes [BR:spat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A0O21_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(269652..271055)
Genome map
AA seq 467 aa AA seqDB search
MALYGKHNQEKHDVLSPIFGSVSEDHDLPKYKLNQTPVEPRIAYQVIKDQLLDEGNARLN
LATFCQTYMEPEAIQLMSETLEKNAIDKSEYPRTAEIENRCVNMMADLWHAQPEEEFLGT
STVGSSEACMLGGLAMKFAWRKRAESLGLDTSAQKPNLVISTGYQVCWEKFCTYWDIELR
TVPMDKEHQSLNMETVMDYVDPYTIGIVGIMGITYTGRYDNIKQLNDLVEAYNSHTDFKV
YIHVDAASGGFYAPFMEPEIAWDFRLKNVISINTSGHKYGLVYPGIGWILWRDKAFLPEE
LIFRVSYLGGEIPTMAINFSRSASQIIGQYYNFIRYGYDGYRAIHQRTHDVALYLAKEIK
ALDCFEMVNDGAHLPIICYKQKDAKQQEWTLYDLADRLAMKGWQVPAYPLPADLDQTEVQ
RLVVRADFGMGMAHDYIEDMKAAIADLDRAHILFHEKKEIKNYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcactctacggtaaacataatcaggaaaaacatgatgtcctcagtcccatctttgga
tctgtcagtgaggatcacgatttaccaaaatataagctcaaccaaacgcctgttgagccg
agaatcgcttatcaggttatcaaggatcagctgcttgatgaagggaatgctcgtctgaat
ttggctactttttgccagacctatatggaacctgaagcgatacagctgatgagcgagacg
ctggaaaaaaatgctattgataaatcagaatatccgcgtacagcagaaattgaaaaccgc
tgtgtcaatatgatggctgatttatggcacgctcagcccgaagaagaatttttgggcaca
tcaactgtcggttcttctgaagcttgtatgctgggtggattggctatgaaatttgcctgg
cgtaaacgggccgaaagtctcggtctggacaccagtgctcaaaagccaaacttagttatt
tcaaccggctatcaagtctgttgggagaaattttgcacctactgggacattgaactgcgg
actgttcctatggataaggaacaccagtcactaaatatggaaacggtcatggactatgtt
gacccttacacaattggtattgtcggcattatgggtatcacctatacaggccgttatgac
aatattaagcagctcaatgacctggtggaagcctataacagccacacagattttaaggtt
tatatccatgttgatgcggcgtccggcggtttttatgcgccttttatggaaccggaaatc
gcttgggattttcgcctaaaaaatgtcatctctattaacacttccggtcataaatacgga
cttgtttatccgggaatcggctggattctttggcgtgataaagcttttctgccggaagaa
ttaatctttagggtgagttatttgggaggagaaatcccgacaatggccattaatttttcc
cgcagtgcctcacaaatcatcggccagtattataattttattcgttacggctatgacggc
taccgcgcaattcatcaacggacccacgacgtcgctctctacctggcaaaagaaataaag
gccttagattgtttcgagatggttaatgatggggcgcacctgcctattatctgctacaaa
caaaaagatgctaaacagcaggaatggacactttatgatttggccgaccgtctggctatg
aagggttggcaagttccggcttatcctttacctgctgatttggaccaaactgaagtacag
cgtctggttgtgcgtgctgactttggtatgggcatggcgcatgactatatagaagatatg
aaggcagctatagcagatctcgaccgagcccatatccttttccatgagaaaaaagaaatc
aaaaactacggcttcacacactaa

DBGET integrated database retrieval system