KEGG   Streptomyces parvulus: Spa2297_17605Help
Entry
Spa2297_17605     CDS       T04685                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
spav  Streptomyces parvulus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spav00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Spa2297_17605
Enzymes [BR:spav01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Spa2297_17605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3875031..3876290
Genome map
AA seq 419 aa AA seqDB search
MSEPLDPAGEAAAVDLAGEARRLDAADALAPLRERFVLDDVTYLDGNSLGALPVHVPARV
DDVVRRQWGELRIRSWEESGWWTAPERIGDRIAPLVGAAAGQIVVGDSTSVNVFKALVAA
VRMAREDVGDGGEGGGAVRDEILVDATTFPTDGYIAESAARMTGCALRAVTPAEVPGALG
DRTAAVLLNHVDYRTGRLHDLPGLTRAVHACGAYAVWDLCHSAGALPVGLDEHGVDLAVG
CTYKYLNGGPGSPAYLYVRRDLQPRFDSPLPGWNSHAEPFGMRSAYAPASGAVRGRVGTP
DILSLLALEAALDVWDADGVSVAGVRAKSLALTDFFLRCVGAYVPAGRVESVTPAAHAER
GSQVALRCDDAGEVMKRLVESGVVGDFRAPDVLRFGFTPLYVGFADVERAARVLARTLG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcccctggaccccgccggggaggccgcggccgtggacctggccggggaggcg
cggcgcctcgacgcagccgacgcgctggcgcctctgcgcgagcggttcgtcctcgacgac
gtgacctacctcgacggcaactcgctcggcgccctcccggtgcacgtccccgcgcgcgtg
gacgacgtcgtccgccgccagtggggcgaactgcgcatccgctcctgggaggagagcggc
tggtggacggcgcccgagcggatcggcgaccggatcgcaccgctggtcggcgcggccgcc
gggcagatcgtcgtgggcgactccacgagcgtgaacgtcttcaaggcgctcgtcgccgcc
gtgcgcatggcgcgggaggacgtcggcgacggcggcgaagggggcggcgcggtccgggac
gagatcctggtcgacgccaccaccttccccacggacgggtacatcgccgagtcggcggcc
cggatgacggggtgcgcgctgcgtgccgtgaccccggccgaggtccccggcgcgctgggc
gaccgcaccgccgccgtcctcctcaaccacgtcgactaccgcaccggccgcctgcacgac
ctgcccgggctcacccgcgcggtgcacgcgtgcggggcctacgccgtgtgggacctgtgc
cacagcgcgggcgccctgccggtcgggctcgacgaacacggcgtcgacctcgcggtcggc
tgcacctacaagtacctcaacggcggccccggttcgcccgcctacctgtacgtgcgccgc
gatctccagccgcgcttcgactccccgctgccgggctggaactcgcacgcggagccgttc
ggcatgcggtccgcctacgccccggcgtccggcgccgtccgcggccgggtcggcacgccg
gacatcctgtcgctgctcgccctggaggcggcgctggacgtgtgggacgcggacggcgtc
tcggtggcgggggtgcgggccaagtcgctcgcgctgacggacttcttcctgcgctgcgtc
ggggcgtacgtgcccgccggccgggtcgagtccgtgacaccggcggcacacgccgagcgc
ggcagccaggtcgccctgcgctgcgacgacgcgggcgaggtcatgaagcggctcgtcgag
agcggagtggtcggcgacttccgcgcgccggacgtgctccgcttcggcttcaccccgctg
tacgtcggcttcgcggacgtggagcgggcggcccgggtgctggcgcgcacgctcgggtga

DBGET integrated database retrieval system