KEGG   Streptomyces parvulus: Spa2297_22305Help
Entry
Spa2297_22305     CDS       T04685                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
spav  Streptomyces parvulus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spa2297_22305 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    Spa2297_22305 (kgd)
   00380 Tryptophan metabolism
    Spa2297_22305 (kgd)
Enzymes [BR:spav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Spa2297_22305 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4882679..4886497)
Genome map
AA seq 1272 aa AA seqDB search
MSPQSPSNSSISTDTDQAGKNPAAAFGANEWLVDEIYQQYLQDPNSVDRAWWDFFADYKP
GAPATPAAAPGATATDAGSAPQAAPAPQAQAPAPAQPKAAPQPAAPAKPAAKPAAAAPAA
KPAQAPAKPAAQPQAKAAAPAKDGKDAAAPEGPEMVTLRGPAAAVAKNMNASLELPTATS
VRAVPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPTMNYAFGEKDGKPT
LVKPAHVNLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARDGKLTMDD
FSGVTVSLTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMT
LTSTYDHRVIQGAASGEFLRQVANLLLGENGFYDEIFKALRIPYEPVRWLKDIDASHDDD
VTKAARVFELIHSYRVRGHVMADTDPLEYQQRKHPDLDITEHGLTLWDLEREFAVGGFAG
KSLMKLRDILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRIERSHTKPEREEQLRILRRL
NAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAESRLDEVVVGMAHRGRLNVL
ANVVGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQIKVSLVANPSHLE
AVDPILEGVSRAKQDIIGKGGTDFTVLPVAIHGDAAFAGQGVVAETLNMSQLRGYRTGGT
VHVVINNQVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEACVRVARLAFEFRQAF
NKDVVIDLICYRRRGHNETDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQ
ALQDYQGQLEKVFTEVREAASQPASAEPSEPQAEFPVAVTTAVSAETVKRIAESQVNIPD
HITVHPRLLPQLQRRAAMVEDGTIDWGMGETLAVGSLLLEGVPVRLSGQDSQRGTFGQRH
AVVIDRETGDEFTPLLYLSEDQSRYNVYNSLLSEYAVMGFEYGYSLARPDALVMWEAQFG
DFVNGAQTVVDEFISSAEQKWNQTSGVTLLLPHGYEGQGPDHSSARPERFLQLCAQNNMT
VAMPTLPSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASKAEEFTTGQFRPVIGDDS
VDPAAVKKVVFTAGKVYYDLDAERKKRGVTDTAIIRIERLYPLPGAELQAEIAKYPNAEK
YLWAQEEPANQGAWPFIALNLIDHLDLAVGADIPHGERLRRISRPHGSSPAVGSAKRHQA
EQEQLVREVFEA
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctcgaccgacaccgaccaagcgggcaag
aaccccgccgcggcgttcggtgccaacgagtggctcgttgacgagatctatcagcagtac
ctccaggacccgaattccgtggaccgagcctggtgggacttcttcgccgactacaagccc
ggagcgcccgcgaccccggccgccgcccccggtgccacggccacggacgccggcagcgca
ccgcaggccgcccccgcgccgcaggcgcaggcccccgccccggcgcagccgaaggcggcg
ccccagccggccgcccccgcgaagccggccgccaagcccgccgccgcggctccggccgcg
aagcccgcgcaggcgccggccaagcccgccgcccagccgcaggcgaaggccgccgcgccc
gccaaggacggcaaggacgccgccgcccccgagggccccgagatggtgaccctgcgcggc
cccgccgccgcggtcgcgaagaacatgaacgcctccctggagctgcccacggccacgtcc
gtgcgcgccgtcccggtgaagctgctgttcgacaaccgcatcgtcatcaacaaccacctc
aagcgcgcccggggcgggaagatctccttcacgcacctgatcggctacgcgatggtgcag
gccatcaaggccatgccgacgatgaactacgcattcggcgagaaggacggcaagccgacc
ctcgtcaagccggcgcacgtcaacctcggcctcgccatcgacctggtcaagcccaacggc
gaccgccagctggtcgtcgcggcgatcaagaaggccgagacgctgaacttcttcgagttc
tggcaggcctacgaggacatcgtccgccgcgcccgcgacggcaagctgacgatggacgac
ttctccggcgtcacggtctccctgaccaaccccggcggcctcggcaccgtccactccgtg
ccccgtctgatgcccggccagtccgtcatcatgggcgtcggctccatggactaccccgcg
gagttccagggcaccagccaggacaccctgaacaagctcggcatctcgaaggtcatgacg
ctcacgtcgacctacgaccaccgggtcatccagggcgccgcctccggcgagttcctgcgc
caggtcgccaacctgctcctcggcgagaacggcttctacgacgagatcttcaaggcgctg
cgcatcccctacgagccggtccgctggctcaaggacatcgacgccagccacgacgacgac
gtcaccaaggccgcccgcgtcttcgagctgatccactcctaccgggtccgcggccacgtc
atggccgacaccgacccgctggagtaccagcagcgcaagcaccccgacctggacatcacc
gagcacgggctcaccctgtgggacctggagcgcgagttcgcggtcggcggcttcgcgggc
aagtccctgatgaagctgcgcgacatcctcggcgtgctgcgcgactcgtactgccgcacc
accggcatcgagttcatgcacatccaggacccgaagcagcgcaagtggatccaggaccgc
atcgagcgctcgcacaccaagccggagcgcgaggagcagctgcgcatcctgcgccggctg
aacgcggcggaggccttcgagaccttcctgcagaccaagtacgtcggccagaagcgcttc
tccctggagggcggcgagtccgtcatcccgctgctcgacgcggtcatcgactcggcggcc
gagtcccgcctggacgaggtcgtcgtcggcatggcccaccgcggccggctgaacgtgctg
gccaacgtcgtcggcaagtcgtacgcccagatcttccgcgagttcgagggcaacctcgac
ccgaagtcgatgcacggctccggcgacgtgaagtaccacctgggcgccgagggcaccttc
accggcctggacggcgagcagatcaaggtctcgctggtcgccaacccctcgcacctggag
gcggtcgacccgatcctggagggcgtctcgcgcgccaagcaggacatcatcggcaagggc
ggcacggacttcaccgtcctgccggtggcgatccacggcgacgcggccttcgcgggccag
ggcgtggtggccgagaccctgaacatgtcgcagctgcgcggctaccgcaccggcggcacg
gtccacgtcgtcatcaacaaccaggtcggcttcaccgccgccccggagtcctcgcgctcc
tcgatgtacgccaccgacgtggcccgcatgatcgaggccccgatcttccacgtgaacggc
gacgacccggaggcctgcgtccgcgtggcgcggctggccttcgagttccgccaggcgttc
aacaaggacgtggtgatcgacctcatctgctaccgccgccgcggtcacaacgagaccgac
aacccggccttcacccagccgctgatgtacgacctgatcgacaagaagcgctcggtgcgc
aagctctacaccgagtccctcatcggtcgcggcgacatcaccctggaggaggccgagcag
gcgctccaggactaccaggggcagctggagaaggtcttcaccgaggtccgcgaggccgcc
tcgcagcccgcctccgccgaaccgtcggagccgcaggccgagttcccggtcgccgtgacc
accgcggtcagcgccgagacggtcaagcggatcgccgagtcccaggtcaacatccccgac
cacatcaccgtgcacccgcggctgctgccgcagctccagcgccgggcggcgatggtcgag
gacggcacgatcgactggggcatgggcgagaccctcgccgtcggctcgctgctcctggag
ggcgtgccggtccggctctccggccaggactcgcagcgcggcaccttcggccagcgccac
gcggtcgtcatcgaccgcgagacgggcgacgagttcacgccgctgctgtacctgtccgag
gaccagtcccggtacaacgtctacaactcgctgctctccgagtacgcggtgatgggcttc
gagtacggctactcgctggcccgcccggacgcgctggtgatgtgggaggcgcagttcggc
gacttcgtcaacggcgcgcagacggtcgtcgacgagttcatctcgtcggccgagcagaag
tggaaccagacgagcggcgtgacgctcctgctcccgcacggctacgagggccagggcccg
gaccactcctcggcccgcccggagcgcttcctccagctctgcgcgcagaacaacatgacg
gtcgcgatgccgaccctgccgtcgaactacttccacctcctgcggtggcaggtgcacaac
ccgcaccacaagccgctggtcgtcttcaccccgaagtcgatgctgcgcctgaaggccgcg
gcctcgaaggcggaggagttcacgacgggccagttccgcccggtcatcggcgacgactcg
gtcgacccggccgccgtcaagaaggtcgtcttcaccgccggcaaggtctactacgacctc
gacgccgagcggaagaagcgcggcgtgaccgacacggccatcatccgcatcgagcgcctg
tacccgctgccgggtgccgaactccaggcggagatcgccaagtacccgaacgccgagaag
tacctgtgggcccaggaggagccggcgaaccagggtgcctggccgttcatcgcgctcaac
ctgatcgaccacctggacctcgcggtcggcgccgacatcccgcacggcgagcgcctgcgg
cgcatctcgcgcccgcacggctcgtccccggcggtcggctccgccaagcgccaccaggcg
gagcaggagcagctggtgcgtgaggtcttcgaggcctga

DBGET integrated database retrieval system