KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1139Help
Entry
M28_Spy1139       CDS       T00263                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Brite
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M28_Spy1139 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1144563..1145168)
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQALINNGGGHLNHALFWELLSPEKQDVTPDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVSELYQAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatacgcgtatgatgctcttgaaccacagtttgat
gcggagacaatgactcttcatcatgataaacaccatgccacttatgtcgctaataccaat
gcggctttagaaaaacacccagagatcggagaaaatctggaggaactattggcagatgtc
actaagattccagaagatattcgtcaagccttaattaataatggtggcggacacctaaac
catgcgcttttctgggaactattatcacctgaaaaacaagacgtcactcctgatgttgca
caagccattgatgatgcttttgggtcatttgacgcctttaaagaacaatttacagcagct
gctactggacgttttggttcaggttgggcatggttagttgttaataaagaaggacaactc
gaaatcacatcaaccgctaaccaagatactccaatttcagaaggcaaaaaaccaattcta
gcgcttgatgtgtgggagcatgcttactacttgaattatcgtaatgtacgtccaaattat
atcaaagctttctttgaaatcattaattggaaaaaagtatcagaactttaccaagccgct
aaataa

DBGET integrated database retrieval system