KEGG   Shewanella putrefaciens CN-32: Sputcn32_3638Help
Entry
Sputcn32_3638     CDS       T00513                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
spc  Shewanella putrefaciens CN-32
Brite
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sputcn32_3638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABP77346
UniProt: A4YBL3
LinkDB All DBs
Position
4241472..4241993
Genome map
AA seq 173 aa AA seqDB search
MNKLHLASLSILLLSGTAFAQESQVTMELLNAEGNTPIGTISLNDSEFGLVLTPNLSSLT
PGVHGFHVHQTGNCEPVTKDGKTVLGGGAGGHYDPDNTGKHGTPWSTDNHKGDLPPLYVD
EHGKATTAVLAPRLKVNDVKGKSLMVHVGGDNHSDHPAPLGGGGARMACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattacacttagcctcgctctcaatcttgttactgagtggtaccgcgtttgca
caagagtcccaagtaaccatggagttgttgaatgcagagggtaatactccaattggcact
attagcctaaatgactccgaatttggtcttgttctcaccccaaacctgtcatctttaacg
ccaggtgtacatggttttcatgtacatcaaactggcaattgcgagccagtaactaaggat
ggaaaaacagtcttaggcggaggtgcgggtggacattatgatccagacaatacgggtaaa
catggaacgccatggtcaaccgataatcataagggcgatttaccgcctttatacgtcgat
gaacatggcaaggccacaactgcagtactagctcctcgcctgaaggtcaatgatgttaaa
ggtaaatctttgatggtccatgttggtggagataatcattctgatcatccagcacctctt
ggcggcggtggtgcacgtatggcttgtggtgttatcaagtaa

DBGET integrated database retrieval system