KEGG   Solanum pennellii: 107018016Help
Entry
107018016         CDS       T04130                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2-like
Organism
spen  Solanum pennellii
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 107018016
NCBI-ProteinID: XP_015073836
LinkDB All DBs
Position
4
AA seq 1394 aa AA seqDB search
MVQAVEHNGVLEIAQSEHKKSKTTKKGKGKGRQGKNHTGQNSQRSKGKSSIPTGPISLKV
KFGSRCLMDVVPLIDDHMDKQCTTGKEFKELPNVARNFDDRLEAGLPSLQFSSCNRNLDN
VYVSVSELCLSGKNISQEPVDKLLDFHHESPSQEGTSIDNRCSDSGTSPDSEVINLVPDN
QIIEGEPEELNDLIPSRPSVAPGDVLSLRVYDRSKKGRKKDRLPKFASSGSKDMLSSDSM
SNSQIFGPLMQGDKVQGCSCYADTSALTIGRISSGNISSTEIISGELLPCSGVPEFNISC
AASKLGSGIEGNVCSSFGTESPETEFAEKVVSCHDGQNITKSERSNLSGKGTQVPNQKLS
KSRESASKKKGNKEKQDNKLEVRHENNQVKSLSEVNHHPGTENEAPYGFGEVGSRNETLS
GGISDLDIMRSEVSQPYLQPRNAWVQCDDCQKWRRIASVLADKIEETNCKWTCKDNLDRD
LADCSIAQEKSNSEINAELEISDASGEEDVVRTRLNSNRSGQKKAPVSLQSSWTLIKRNS
FLHRSRKSQTIDEIMVCHCKPSERRMGCGEGCLNRMLNVECVRGSCPCGERCSNQQFQKR
NYAKLKCFKCGKKGYGLQLLEDVSKGQFLIEYVGEVLDLHAYDARQKEYALKGHKHFYFM
TLNGSEVIDACAKGNLGRFINHSCDPNCCTEKWMVNGEVCIGLFALRDIKKGEEVTFDYN
YVRVFGAAAKKCVCGSPRCLGYIGGDLQNAEVIVQADSDDDYPEPVVLCEDGDMGDELNK
ILSARSSFDVTEIRTPGETPKNKYKLDEPFTGNLENTTHTQNIMKQENSNMDNSVAAFGL
KIKEESNKSHNESPSLSLKKKESSEAMEGLESLLHSSVRPVGNSLQSEDITAKTISEVKR
ECLDAVKISSALPSPNAMLSKSLRKKSGNGEASDESLKSSRRSSSVKKGKSKNSAVNMTS
APDVNNKLQIPQPKFKKPTHDSANGRFEAVEEKLNELLDHDGGISKRRDASRCYLKLLLL
TAASGDNCNGEAIQSNRDLSMILDALLKTKSRTVLVDIIDKNGLQMLHNIMKRSQREFNK
IPILRKLLKVLEYLAARGILSHEHINGGPSRPGVESFRVSILGLTEHIDKQVHQIARNFR
DRWIRRPLRKSSCIDRDDSQIDLRPSPRYNRCSPLQDHCGVKPSETEECTSHLMVESTRI
DAGVLDGSSTSCVDGATNGARKRKRKSRWDQEAELDVDQRIETNAVDDRTQDIDDAPPGF
SIPKKASRISCGASSSADCSLQEPSCKKHPHPVVTGHLQQRFISRLPVSYGIPLSKVQQF
GSPQKERYDAWVVAPGVPFHPFPPLPTYPHDRRDPISPADNAAGIFSEPPQNPQHGQSTH
NPPRLSGASLRKIL
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagctgttgaacacaacggtgtgctcgagatagctcaaagtgagcacaaaaaa
tcaaaaacaacaaagaagggtaagggaaaagggaggcagggcaaaaatcacactggtcaa
aactcgcagagatcaaaaggaaaaagctccattcctaccggccctatctccttgaaagtt
aaatttggttcacgttgcctgatggatgttgttcctcttattgatgatcacatggacaaa
cagtgtactactggaaaagaattcaaagaattgccaaatgttgcaagaaattttgatgat
cggttggaggcagggttgcccagtctgcagttctccagttgcaacagaaatttggataat
gtgtatgtttctgtatctgaattatgcctatctggaaagaacatcagtcaagaaccagtg
gacaagcttttggactttcaccatgagtcaccttctcaggagggaacatcaattgataac
aggtgctcagattctggaacttcgcccgactcagaagttatcaacctggttccggataat
caaattattgagggagaaccagaagagttgaatgatttaatcccgtctaggccatctgtt
gctcctggagatgttctgagtttgcgtgtgtatgacaggagcaagaaaggaaggaaaaaa
gataggctcccaaagtttgccagttctggttcaaaagatatgcttagttcagatagtatg
agcaattcccaaatatttggtccacttatgcaaggagataaagtacaagggtgctcttgt
tatgcggatacttctgctttaacaataggtagaattagctcaggcaacatatctagcact
gagattatttcaggggaactgttaccttgttcaggagtgccagagttcaatatttcctgt
gctgcttcaaagcttggaagtggcatagagggtaatgtttgttctagctttggcaccgag
tcaccagaaactgagtttgctgaaaaagtggtatcttgtcatgatggacaaaatattacc
aaaagtgaaagatcaaatttatctggcaaaggcacacaggtcccgaatcagaagttatcc
aaaagtagagaaagtgcttctaaaaagaagggaaacaaagaaaagcaagataataagctt
gaagtgagacatgagaataaccaggtcaagagtttaagtgaggtgaaccaccacccagga
acagaaaacgaagcaccatacgggtttggagaagttggatccagaaatgaaaccttaagt
ggaggcatctcagacttggacattatgcggagtgaggtgagtcagccttatttacagcca
agaaatgcttgggtgcagtgtgatgattgccagaaatggaggcgtatagcctctgtactt
gctgataaaattgaagaaacaaactgcaaatggacttgtaaggataatttggatagagac
ttggctgattgctcgattgcacaagaaaaatcaaattcagaaattaatgctgagctggaa
atatcagatgcctctggtgaggaagatgtcgtccgtacacgcttgaattcaaatcgatca
ggacagaagaaggctcctgtttcccttcaatcatcttggaccctgattaagagaaattca
ttcctgcatcgtagccgcaaaagtcaaactattgatgagatcatggtctgccattgcaag
ccttcagaacgccgaatgggatgtggggagggatgcctgaatcggatgctcaacgttgag
tgtgttcgagggagttgtccatgtggagaacgttgttcgaatcagcagttccagaaacgc
aactatgctaaattgaagtgctttaaatgtggaaagaaggggtatggcctgcagctgctt
gaggatgtctccaaagggcagtttcttattgaatatgttggggaggtgttggacttgcat
gcgtatgatgcaagacaaaaggagtatgccctaaagggtcataagcatttctatttcatg
acacttaatggcagtgaggttatagatgcatgtgctaaagggaatttgggacgtttcatt
aaccatagctgtgatcctaattgctgcacagaaaagtggatggtcaatggagaagtttgc
attggactctttgccctaagggatatcaagaagggtgaggaggttacatttgattacaat
tatgtgcgtgtctttggggctgcagcgaaaaaatgtgtctgtggctcgcctcgctgtctg
ggctatataggtggagatctgcagaatgccgaagtgatagttcaggctgattcagatgat
gactatcctgaacccgttgttctctgtgaggatggtgacatgggtgacgaactaaacaaa
attctatctgcaagaagttcatttgatgtcacagaaattagaactccaggggaaacacct
aaaaacaaatataaactggatgaaccttttactggaaacctggagaataccacccacaca
cagaatataatgaaacaagaaaattccaacatggacaactctgttgctgcttttggcttg
aagatcaaagaggaaagcaacaagtcgcacaatgaatctccttcattatctctgaagaag
aaggaatcatctgaggcaatggaggggctagaaagcctgttgcattcttctgtacgacct
gttggaaattccttgcaatcggaagatataaccgctaaaaccatatctgaagtcaaaaga
gagtgcttagatgctgtcaaaatttcttctgcactgccatctccaaatgctatgcttagc
aagtctttgaggaagaaatcaggcaatggggaagccagtgatgaatcgttgaaatcttct
cgtcgatcatcttcagttaaaaagggaaagtcgaagaatagtgctgtgaatatgacatct
gcacctgatgtgaacaacaaattgcaaattccacaacctaaattcaagaaaccaacacat
gattccgcaaatggtcggtttgaagcagttgaagagaagcttaatgagttgctggatcat
gatggtggaataagcaaacgcagggatgcatctaggtgctacttgaagctcctcctttta
actgctgcttcaggggataactgcaatggtgaagctattcagagtaaccgggatctttca
atgatccttgatgcgcttttgaagaccaagtcccgcactgttttggtggatattatagac
aagaatggtttgcagatgttacacaacataatgaaacgatctcaaagggaattcaataag
atcccaattctcagaaagttgcttaaggttttggagtatttggctgcgagagggattctt
tctcatgagcacattaatggaggtccctctagaccaggagtagagagctttagggtctca
attttgggattgactgaacacatagacaaacaggttcatcaaattgcaaggaacttcaga
gataggtggatacgtagacctctcagaaaaagtagctgcattgacagagatgacagccag
attgacttgcgtccttctccacggtacaataggtgttcaccattgcaagaccattgtggt
gtgaaaccctcagaaacagaagaatgtacctcacatttaatggtagaatctactaggata
gatgctggtgtccttgatggctcatctacttcatgtgttgatggggcaaccaatggagca
aggaaacgtaagcgtaagagtcgatgggatcaagaggcagaactagatgtagatcaaaga
attgaaaccaatgcggttgatgatcgaacgcaggacatagatgatgcccctcctgggttt
tcaatccccaagaaggcctctaggatctcatgcggtgcttcttcaagtgcagattgtagt
ctccaagaacccagttgcaagaagcatccgcatccagtggtcacagggcatctgcagcag
aggtttatttcacgattgccagtctcctatggaattccactttccaaagtgcagcagttt
gggtcacctcaaaaagaaagatatgatgcttgggttgttgctccaggagtaccttttcat
ccttttcctcctttgcctacatatccccatgatagaagagatcctatatctcctgcagat
aatgccgctggaatttttagcgagccacctcaaaatccacaacatggccagtctactcat
aatcccccacgcctctctggcgcaagcctccgcaagattctgtaa

DBGET integrated database retrieval system