KEGG   Sphingomonas sp. DC-6: HY78_27855Help
Entry
HY78_27855        CDS       T05200                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphd  Sphingomonas sp. DC-6
Pathway
sphd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HY78_27855
Enzymes [BR:sphd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HY78_27855
Transporters [BR:sphd02000]
 Other Transporters
  Pores ion channels [TC:1]
   HY78_27855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ARR56983
UniProt: A0A1X9UMF3
LinkDB All DBs
Position
5905419..5905997
Genome map
AA seq 192 aa AA seqDB search
MRVYGDSISGNCLKVKWTADLLGIRHEWIETSVLDGATRTPDFLAINPAGQVPLVRYDDG
RTLAQSNAIILSLAEGSALIPADAHQRAKMLEWLFWEQYSHEPYVAVARFQVHYLGKAVA
DLEPRVVERGKGALKLLDEQLTGRTFLVGDALSLADIALVAYTRVAHQGGFDLGDYPAVQ
RWIGRVEEALGI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtctatggcgattcgatttccggcaactgcctgaaggtcaaatggacggccgac
ctgctggggattcgccatgagtggatcgagacgagcgtgctcgacggagcgacgcggacg
cccgatttcctggcgataaacccggcgggacaggtgccgctggtccgctatgacgacggc
cgcaccctcgcccagtcgaacgcgatcatcctgagcctcgccgaaggatcggcgctgatc
cccgccgacgcccatcagcgggcgaagatgctcgaatggctgttctgggagcaatatagc
cacgagccctatgtcgcggtggcgcgcttccaggtccattatctgggcaaggcggtggcc
gatctggagccccgcgtggtcgagcgcggcaagggcgcgctcaagctgctcgacgagcaa
ctgaccgggcggaccttcctggtcggcgacgcgctcagcctcgccgacatcgcgctggtc
gcctatacgcgggtcgcgcatcagggcgggttcgatctgggcgactatccggcagtgcag
cgctggatcgggcgggtggaagaggcgctggggatctag

DBGET integrated database retrieval system