KEGG   Sphingorhabdus sp. M41: AZE99_04640Help
Entry
AZE99_04640       CDS       T04317                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sphg  Sphingorhabdus sp. M41
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
959784..961259
Genome map
AA seq 491 aa AA seqDB search
MTPEGVLIKNTDKIWIGGEWVHAHSKREIELVSPNSEEVIGSVAEADEADMDAAVAAARF
AFDEGPWSRMQPQERIALLKKMAVHLHGRTEEIAKAWTLQMGGLASFAGPMTGGSTMNFD
QIIAMAEKFEFVEQRPSPVVHTALIAHEPVGVVAAIAPWNGPYGIMLNKVAYALAAGCTL
IMKPSPETPLEAYIIAEAAEAAGLPAGVVNLVCGHRDASDHLVCNPGVDKVSFTGSTIAG
KRIASVCGERIARCTLELGGKSAAIIADDFDIDAAAQMLTGTITMMSGQVCAMLSRVLVP
KARHDQLAEAIAGEMKKVVIGPSDDPATQLGPLAMKRQLERVEMYIGEGRKTADLVTGGG
RPSHLNRGYFIEPTLFANVDNASRIAQEEIFGPVLCLIPFEDEEDAIRIANDSSYGLNGS
VLTNDVDTAYRIARRIRTGAVGQNGMRMDFGLPFGGFKQSGIGREGGIEGLLGYLETKTI
LLDGTPSSFSP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgaaggcgttcttatcaaaaataccgacaaaatatggattggcggcgaatgg
gtccatgctcattcgaaacgcgagatcgagctggtgtcacccaatagtgaagaagtgatc
ggttccgtcgccgaggccgacgaagcggatatggatgcagcggtcgcggcggcgcgcttt
gcttttgatgaaggcccctggagccgaatgcagccgcaagaacgcattgcgctgctcaag
aaaatggcagtacatctgcacggacgaaccgaggaaattgcgaaagcgtggactttgcaa
atgggcggactcgccagtttcgccggaccaatgaccggcggttctacgatgaatttcgac
cagatcattgccatggcggagaaatttgaatttgtggagcagcggccatccccggttgtt
cacaccgccttgattgcacatgaaccggtcggagtcgttgccgccatcgctccctggaac
gggccctatggtatcatgctcaacaaggtcgcctatgcgcttgccgccggctgcacgttg
atcatgaagccgtcgccggaaacgccgctggaggcctatattatcgccgaagccgccgaa
gcggcaggccttcctgccggtgttgtcaatctcgtctgcggtcaccgcgatgcgagcgat
catctggtttgcaatccgggagtcgacaaggtcagctttaccggatcgaccatcgccggc
aagcgcatcgccagcgtctgcggtgagagaattgcgcgctgtacgctggaactgggcggc
aagtctgccgcgatcattgccgatgacttcgatatcgatgcagccgcgcagatgctgacc
ggcaccatcacgatgatgagcggccaggtctgcgccatgctcagccgcgtgctcgtgcca
aaggctcgccatgaccaactggccgaggcaattgccggcgaaatgaaaaaggtcgtgatc
ggtccatcggacgatcccgcaacacagctcggcccacttgccatgaaacggcagctggag
cgcgtcgaaatgtatatcggggaaggcaggaaaaccgccgatcttgtcactggaggcgga
cggccaagccatcttaatcgcggctatttcatcgaaccgacgcttttcgccaatgtcgac
aacgcatcgcggattgcacaggaagagatttttggtccggtgctttgcctcatccccttc
gaggatgaagaggatgcgatccgcatagccaatgattccagctatggattgaacgggtcg
gtgctgaccaatgatgtggacacggcctaccggatagcgcgccggatccggaccggtgca
gtcggacaaaatggtatgaggatggactttggccttccctttggtggcttcaaacagtcg
ggcatcggccgcgaaggcgggatcgaaggcttgctcggctatctagaaaccaagaccata
ttgctcgatggcacaccatccagcttttcgccttga

DBGET integrated database retrieval system