KEGG   Sphingorhabdus sp. M41: AZE99_14900Help
Entry
AZE99_14900       CDS       T04317                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AZE99_14900
Enzymes [BR:sphg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AZE99_14900
Transporters [BR:sphg02000]
 Other Transporters
  Pores ion channels [TC:1]
   AZE99_14900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3126929..3127600
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRLLLGEKSVGYELVRESPWDQRDEFLSMNPTGRTPVMKHSERDI
HLVDSVAICEYIEETVEKVPMINGTAVNRAEIRRLVAWFDEQFYGDVTAPMMHERMHKRL
VRREPPEAKILREAMRRANVHLDYIDYLIDHRSWLAGATMSLADLAAAAQISVADYLGAI
DWAGHEQTKAWYSMFKSRPSFRPLLSERMEVIAPPAHYEKVDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctgtaccaattccccctatgtccgttttcccgcaaagtccgcttgttgctg
ggcgagaagtcggttggctatgagcttgtccgcgaatcgccatgggatcagcgcgacgaa
tttctgtcgatgaacccgaccggccgaacaccggtgatgaaacatagcgagcgcgacatc
catctggtcgacagcgtcgccatctgcgaatatatcgaggaaacggtcgagaaggttccg
atgatcaacggcacggcagtgaaccgggccgagatccggcgtcttgttgcctggtttgac
gagcaattttacggcgacgtgaccgcgccaatgatgcacgagcggatgcacaaacgactg
gtccggcgggagccacccgaggccaagatcctccgcgaagcgatgcgccgggcgaacgtc
cacctcgactatatcgactatctgatcgaccaccgcagctggctggccggggcgacgatg
agcctcgccgaccttgccgcggcggcccagatttccgtcgcggattatctcggtgcgatt
gactgggccggacatgaacagaccaaggcctggtacagcatgtttaagtcacgcccctcg
ttccggccgctgctgtccgaacgcatggaagtgattgcgccaccagcgcattacgaaaaa
gtggatttttga

DBGET integrated database retrieval system