KEGG   Sphingomonas sp. JJ-A5: BSL82_07745Help
Entry
BSL82_07745       CDS       T04967                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BSL82_07745
Enzymes [BR:sphj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BSL82_07745
Transporters [BR:sphj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSL82_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_C GST_C_3 GST_N_2 S100PBPR
Motif
Other DBs
NCBI-ProteinID: API59214
UniProt: A0A1L3ZU90
LinkDB All DBs
Position
1485940..1486599
Genome map
AA seq 219 aa AA seqDB search
MTLEVYGHPFSSYCQKVFIALYENATPFDFRMIDPDHPENAAEWARLWPLKRFPLLVDNG
RPVMEATVIIEHLGLHHPGPVELVPADPKAALPVRAMDRFFDNYIMTPMQRIVGDSLRPA
EARDSFGVSEARTLLDTAYQWLDDRMSGGQWAAGDSFTLADCAAAPSLFYADWAHPMDGR
FPHVAAYRQRLLARPSVARAVDEARPYRSFFPLGAPDRD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgaggtttatggccaccccttttcctcctactgccagaaggtcttcatcgcg
ctctacgagaacgcgaccccgttcgacttccggatgatagaccccgatcacccggagaat
gcggcggaatgggcgaggctctggccgctgaagcgctttccgctgctggtcgacaacggc
cgcccggtcatggaggcgacggtcatcatcgagcatctgggccttcatcatcccggcccg
gtggagcttgtcccggccgatccgaaggccgcgcttcccgtcagggcgatggaccgcttc
ttcgacaactacatcatgacgccgatgcaacggatcgtcggcgacagcctgcgccccgcc
gaggcgcgtgactccttcggcgtttccgaagcgcggacgctgctcgacaccgcctatcag
tggctggacgaccggatgagcggcggccaatgggcggccggggacagcttcacccttgcc
gattgcgccgcagcgccttcgttattctatgccgactgggcgcatcccatggatggccgc
ttcccacatgtggccgcttaccggcagcgcctgctcgcgcgcccgtccgtcgcgcgcgcc
gtagacgaggcgcggccgtatcgaagcttttttccgctgggcgcgcccgaccgggattga

DBGET integrated database retrieval system