KEGG   Sphingopyxis fribergensis: SKP52_20915Help
Entry
SKP52_20915       CDS       T03542                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
sphk  Sphingopyxis fribergensis
Brite
Translation factors [BR:sphk03012]
 Eukaryotic Type
  Elongation factors
   SKP52_20915 (tuf)
 Prokaryotic Type
   SKP52_20915 (tuf)
Mitochondrial biogenesis [BR:sphk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SKP52_20915 (tuf)
Exosome [BR:sphk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SKP52_20915 (tuf)
  Exosomal proteins of breast cancer cells
   SKP52_20915 (tuf)
  Exosomal proteins of colorectal cancer cells
   SKP52_20915 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4409526..4410719
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAENVAGNAAVDFANIDKAPEERER
GITISTAHVEYETDGRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEH
ILLAKQVGVPTMVVFLNKVDQLDDPELLELVELEIREELSKRDFDGDNIPIIPGSALAAL
EGRDDAIGKDAILKLMAAVDAWIPQPERPLDKPFLMPIEDVFSISGRGTVVTGRIETGVV
KVGEEVEIVGIKDTKKTVVTGVEMFRKLLDQGQAGDNVGALIRGVGREEVERGQVLAKPG
SITPHTEFTSEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNV
QLSVKLIAPIAMDPGLRFAIREGGRTVGAGVVATVTK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctaaatttgagcggacgaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacctcgctgaccgcagcgatcaccaaggtgctcgccgaaaacgtc
gccggcaacgccgccgtcgacttcgcgaacatcgacaaggctcccgaagagcgcgagcgc
ggcatcacgatttcgaccgcacacgtcgaatatgaaaccgacggccgtcactatgcgcac
gtcgattgcccgggacacgccgactatgtgaagaacatgatcaccggtgccgcccagatg
gacggcgcgatcctcgttgtgtcggccgctgacggcccgatgccgcagaccaaggagcac
atcctgctcgcgaagcaggtcggcgttccgaccatggtcgtcttcctcaacaaggtcgac
cagctggacgatcccgaactgctcgagctcgttgagctcgaaatccgcgaagaactgtcg
aagcgcgacttcgacggcgacaatatcccgatcattccgggttcggctctcgccgccctc
gaaggtcgcgacgacgccatcggcaaggatgcgatcctgaagctgatggctgccgtcgac
gcgtggatcccgcagccggaacgtccgctcgacaagcccttcctgatgccgatcgaagac
gtgttctcgatctcgggtcgcggtaccgtcgtcaccggccgtatcgaaaccggcgtcgtc
aaggttggtgaagaagtcgaaatcgtcggcatcaaggacaccaagaagaccgtcgtgacc
ggcgtcgaaatgttccgcaagctgctcgaccagggccaggctggcgacaacgtcggcgcg
ctgatccgcggcgtcggccgtgaagaagtcgagcgtggccaggttctggcaaagcccggc
tcgatcacgccgcacaccgagttcacctcggaagtgtatgtcctgtcgaaggatgaaggc
ggccgtcacacgccgttctttgcgaactatcgtccgcagttctatttccgcaccaccgac
gttaccggtgaggttatcctccccgagggcaccgagatggtcatgccgggcgacaacgtc
cagctgtcggtcaagctgatcgccccgatcgccatggacccgggtctgcgcttcgcaatt
cgcgaaggtggccgcacggtcggcgcaggggttgtggcgacggtcacaaagtaa

DBGET integrated database retrieval system