KEGG   Sphingobacterium sp. B29: BV902_09690Help
Entry
BV902_09690       CDS       T04670                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphn  Sphingobacterium sp. B29
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BV902_09690
  Energy metabolism
   00680 Methane metabolism
    BV902_09690
Enzymes [BR:sphn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BV902_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2338522..2341098
Genome map
AA seq 858 aa AA seqDB search
MKQSKNEAVFQDEVLTRFELFKSLFLTLPFQRVKDTGTLLPFFAKQCEKGVDQHLTPDEI
IKSFFDQHEEFSSEEQRIDLLFRFVQYIERQVVLFDAIEDSSFQMVGRGDDENVLGALIK
NAEGSEDMRRKIVSKLKDFSVRLVLTAHPTQFYPGPVLGIINDLIDAIKTNDIHSIHLLL
QQLGKTPFINKNKPTPVDEAASLAWFLENVFYKVASEIQSFIDDELDVDTEEVKQLIELG
FWPGGDRDGNPNVSVDSTKKVAALLRTILFRCYYRDFRIVRRRITFRGVEEYMENLQTLF
YENSFNPVEHPADETDNIITNLKAIKNVLEEYHNGLFVEIVDDLLRKVMTFGCFFTTLDI
RQDSRILREATNYLIQHNQEKTGMPLDYLELSESDKQKALKFKELDLTVGEDADPLTKDT
SGVIKLLKEIQRSGSERAAQRFIISNCQQASDILGLRQLFLWSGWKKDALTIDFVPLFET
VDDLTRAADVMKTLYSNKEYKAHLKRRGNKQTIMLGYSDSTKDGGYLMANWSIYRAKIEL
TAISREYDVDLVFFDGRGGPPARGGGKTQRFYASMGKEIANDHIQLTIQGQTISSQYGSL
DTARFNIEQLLHAGIISDLKQRVGDTLTKHQQEIIDKLAELSHHKFMDLRTNELFLPYLE
TMSPLKALSSINISSRPVKRNSGRELRLEDLRAISFVTSWSQLKQNIPGFYGVGTALQWA
EKNNLWKDVQQLYVSSGFFQTLIDNCMMSMTKSNFDITAYMKDDPIYGDFWKTLYAEYQI
TKEYLLKLSGTSKLMENYPVDRESILAREGIVLPLLVIQHFAIRALNSDQLTDAQREDYS
KLIARTIFGVVNAGRNVA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagtaaaaatgaagccgtctttcaggacgaggtattgacacgctttgagctt
ttcaaaagtttgtttttaacattgccatttcaacgtgttaaagataccggtactttatta
ccattttttgcaaagcaatgtgaaaagggtgtggatcagcatttaactcctgatgagatc
ataaagagtttcttcgatcagcatgaggaattttcttcggaagagcaacgtattgatttg
ttatttcgatttgttcaatatatagagcgtcaggttgttttatttgatgcgatcgaagac
tcgtcatttcagatggtgggtcgtggcgatgatgaaaatgtcttaggggcattaattaaa
aacgccgaaggtagcgaagatatgcgccgtaagattgtgtcaaaattgaaggatttttct
gtacgtcttgtattgactgcacatcctacgcaattttatccgggaccggtattgggtatt
atcaacgacctgatcgatgcaatcaagaccaacgatattcatagtattcacctgctgtta
cagcaattggggaaaacgcctttcatcaataaaaataaaccgactccagttgatgaggca
gcgagcttagcttggtttttggaaaacgtgttttataaagtggcatcggagattcagtcg
ttcattgatgatgaattggatgtcgataccgaagaggtaaaacaattgattgagcttggt
ttttggccggggggtgaccgagacgggaatcctaacgtaagtgttgatagcaccaagaaa
gttgccgcattgctacgtactatcttatttagatgttactatagagatttccgtatcgtt
agacgacgcatcacatttagaggtgtggaggagtatatggaaaatctgcagacattgttc
tacgaaaatagttttaacccggtcgaacatcctgctgacgaaaccgataatatcatcacg
aatctaaaagcaatcaaaaatgttttggaggaatatcacaacgggctttttgtagagatc
gttgatgatctactccgtaaagtgatgacttttggttgtttctttaccacattggatatc
agacaagacagccgcatattacgtgaggctaccaattatctgattcagcacaaccaggaa
aagactggaatgccattggattatctggagcttagtgaaagtgataagcaaaaagcatta
aaattcaaagaacttgacttaacggtgggagaggatgcggatccgttaacgaaagatact
tcgggcgtgataaaattattaaaggagattcaacgttccggttctgagcgagctgcacaa
cgctttatcatcagtaattgccagcaagcaagtgatattttgggactgcgtcaattattt
ttatggtctggatggaagaaggatgctttaacgatcgattttgtgcccttgtttgagacc
gttgatgacttgacgagagcagcggacgtgatgaaaaccttgtacagtaataaggagtac
aaggcacatttgaaacgaagaggaaacaaacagacgattatgttgggttattctgatagt
accaaagacggtggatatctgatggcgaactggtcgatctatcgtgcaaaaatcgaactt
acggcgatatcacgcgaatacgatgttgatttggtattttttgatggtcgcggtgggcct
ccagcacgtggtggtggtaaaacgcaacgtttttatgcatctatgggtaaggagattgcc
aacgatcatattcaattgacgattcagggacaaacaatcagtagccagtacggatcttta
gatacagcgcggtttaatattgagcaacttttgcatgccggcattatttcagatttaaaa
caacgtgtgggcgatactttaaccaaacatcaacaggagatcattgataagctagctgag
ttgagtcatcataagtttatggatctacgcacgaatgaattgtttttaccatatttggag
acgatgtcgccattgaaagcgttatcctcgatcaatatttcaagtagacctgtaaaacgt
aactcaggccgtgaattgcgactggaagatttgcgggcgattagttttgtaacttcatgg
agccagttgaagcaaaatattcctggattttatggtgtcggaacagcattgcaatgggct
gaaaaaaataacctctggaaggacgtacagcaattatatgtttcatcgggatttttccag
acattgattgacaactgtatgatgtcgatgacaaagtcaaactttgatattacagcatat
atgaaagatgatcctatttatggtgatttttggaaaactttatatgccgagtaccagata
acaaaagaatatttgttaaaattgagcggaacctcaaaattgatggagaactatcctgtg
gatcgtgagtctattttagcgcgcgagggaattgtattaccgttattggttatacagcat
tttgcgattcgtgcattgaattcggatcagctgactgatgcacaacgtgaagattattcg
aagttaatagcgcgtacaatctttggcgtggtgaatgccggaagaaatgttgcgtaa

DBGET integrated database retrieval system