KEGG   Sphingobacterium sp. B29: BV902_24120Help
Entry
BV902_24120       CDS       T04670                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sphn  Sphingobacterium sp. B29
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sphn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BV902_24120
  Amino acid metabolism
   00310 Lysine degradation
    BV902_24120
   00380 Tryptophan metabolism
    BV902_24120
Enzymes [BR:sphn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BV902_24120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5610345..5613086
Genome map
AA seq 913 aa AA seqDB search
MDNLTYLSNADSAYVDGLYQSYKQDPQSVDFGWQKFFEGFDFGQNAGGTTSSVGEATPEH
VLKEINVLNMINGYRDRGHLFTHTNPVRERRKYYPGKELETFGLAEADMNTVFNAGVEVG
LGPATLKDIRQLVEDTYCRSIGAEFKYIRNPEKIKWLQDRMEADRNMPKFSLDTKKRILN
KLNHAVVFENFLGTKFLGQKRFSLEGAESLIPALDSVIEKGAEIGIQEFVIGMAHRGRLN
VLTNIMGKSYKSVFSEFEGKTYADDPEVNFGGDVKYHLGFSSEVKTNDGKSVHLSLAPNP
SHLETVDPIVEGMVRSKIDFKYEGDSSKIAPIIIHGDAAIAGQGVVYEVTQMSKLDGYKT
GGTVHIVINNQIGFTTNYKDARSGTYCTDVAKITSSPVFHVNGDDAEAVVYAINLAVEYR
QKYKTDVFIDLLCYRRFGHNEADEPKFTQPLLYKIIEKHPNPKEVYAKKLITEGSIDEAY
SKNIEKEFKAELQTKFEESKTVEVLTEEIPMFKGAWEGLRPAKKGEVLTTSDKTKVAKDL
FLKLAKEITTLPSDKKFFRKITRLFEDRAKMITADSYDWAMGELMAYATLLDQGNRVRIS
GQDVQRGTFSHRHAVLTLEDSEEKYVPLANIKGGDKFSIYNSLLSEYAVLGFEYGYASSN
PNSLTIWEAQFGDFYNGAQIIVDQYLSSAETKWKRSNGLVMMLPHGMEGQGPEHSSARIE
RFLELCADENMILANCTTPANYFHLLRRQLVREFRKPLVVFTPKSLLRHPKVVSPLKDFT
EAAFQEVIDDANVAAKDVKRVLFCSGKVYYDLLEKQETDKRKDIAIVRLEQLFPIPTEQL
KAIRKKYNKAKEFVWVQEENENMGAWSYYCRKLMGTEIAFTGFVARKESGSTATGYMKQH
VAQQAEILNKSFE
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggacaatctgacatatttgagtaatgctgattcggcttatgtcgatggcttatatcaa
tcgtacaagcaagatccccaatcggtagatttcggatggcaaaaattctttgaaggtttt
gatttcggtcaaaatgctggtggaacaacaagttcagtaggcgaagctactcctgagcac
gtattgaaagaaatcaatgtgctgaacatgatcaatggctaccgtgaccgtggccaccta
ttcacacacactaaccctgttcgtgagagacgtaaatactatcctggcaaggaattggaa
acgtttggtcttgctgaagcagacatgaacaccgtttttaatgcaggtgttgaagtcggt
ttaggtccagcgacattaaaagacatccgtcaattggtggaggatacttactgccgttct
attggtgcagaattcaaatatatccgtaacccagaaaaaattaaatggttacaggaccgt
atggaagcggaccgtaacatgccaaaattctctttggacacaaaaaagagaattttaaac
aaattaaaccacgccgttgtattcgaaaactttttaggtactaaatttttaggtcaaaaa
cgtttctcattggaaggcgcggaaagtttaatcccagcattagattctgtcattgaaaaa
ggtgcagaaatcggtatccaggaatttgttatcggtatggctcaccgtggccgtctgaat
gtattgactaatatcatgggtaaatcttacaaatcagtattctctgaatttgaaggtaag
acttacgctgatgatcctgaagtaaactttggtggtgacgtaaaataccacttgggcttt
tcatctgaggtcaaaacaaacgatggcaaatctgtccacttaagtttggcaccgaaccct
tcgcatttggaaactgtagatccaatcgttgagggtatggtccgttctaagattgatttc
aaatacgaaggtgactcttctaaaattgcaccgatcatcattcatggtgacgcagcaatt
gctggacaaggtgtagtctacgaagtaacccaaatgtccaaactcgatggttacaaaact
ggcggtacggtacatattgtcatcaacaaccagattggatttacaacgaactacaaggat
gcgcgttctggaacatattgtacagacgtagcaaaaatcacttcttcacctgtgttccat
gtgaacggtgatgatgctgaagcggtagtttatgcgattaatttagcggttgaataccgt
caaaaatataaaacagacgtatttatcgatctgttatgttatagaagatttggacacaat
gaggctgatgaaccaaaattcacgcaaccattgttgtataaaatcatcgaaaaacatccg
aacccgaaagaagtttacgctaaaaaattaattactgaaggaagtattgacgaggcgtat
tctaaaaatatcgagaaagaatttaaagctgaattgcaaactaaatttgaggaatctaaa
acagttgaggtattgactgaagagatcccgatgtttaaaggtgcatgggaaggattgcgt
cctgctaaaaaaggtgaagtattaacaacctcggataaaacgaaagttgcaaaagatcta
ttcttaaaattagcaaaagaaatcacaaccttaccttcggacaaaaaattcttccgtaag
attacacgtttgtttgaagatcgcgccaaaatgatcactgctgattcatacgattgggca
atgggcgaattgatggcctacgcgacattattggatcaaggtaaccgtgtacgtatctcg
ggtcaggatgtacaacgtggaacattctcacaccgtcatgcggtattgacgcttgaagat
tcggaagagaaatatgttcctttagccaatattaaaggtggcgataaattctctatctac
aattcgttactttcagaatatgctgttttgggatttgaatatggttatgcatcttctaat
ccaaattcgttgacaatctgggaagctcaattcggagatttctataacggtgctcaaatt
atcgttgatcaatatttatcgagtgcagagacaaaatggaaacgttctaacggtttagtt
atgatgcttcctcatggtatggaaggtcaaggtcctgagcactcttcagcacgtatcgaa
agattcttagagttatgtgcagatgagaatatgatcttagcaaactgtactactccggct
aactatttccacttgttgcgtcgtcaacttgtacgtgagttccgtaaaccattggttgta
tttacgccaaaatcattgttgcgccaccctaaagtggtatcaccgttgaaagattttaca
gaagctgctttccaagaggtaattgatgatgcaaatgttgcggcgaaagacgttaaacgc
gtgttattctgttcgggtaaagtttactacgacttattagaaaaacaagaaacggacaaa
cgcaaagatatcgctatcgtgagattggaacaattattcccaattcctacagagcaattg
aaagcaatccgtaaaaaatacaacaaggcaaaagaatttgtttgggttcaggaagaaaat
gagaacatgggagcatggtcttactactgccgtaaactaatgggtactgagattgcattt
acaggttttgttgcccgtaaagaaagtggaagtacagctacgggttacatgaaacaacac
gttgcacaacaagcagaaatcttaaataaatcattcgaataa

DBGET integrated database retrieval system