KEGG   Sphingopyxis sp. 113P3: LH20_14325Help
Entry
LH20_14325        CDS       T04069                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LH20_14325
Enzymes [BR:sphp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LH20_14325
Transporters [BR:sphp02000]
 Other Transporters
  Pores ion channels [TC:1]
   LH20_14325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2877994..2878665
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKIRLLLGEKGVGYELVRESPWERRDEFIDLNPAGRTPVMVDQERGQ
VLIDSAAIAEYFEETVETKAMINGTAANRAEIRRLVAWFDQDFYYEVTGPLLFERMQKRI
VHRQPPDAGALREAMKAANNHLDYVDYLIDHRTWLAGATMSLADLAAAAHISVADYLGGI
DWTGHEQTKGWYSGLKSRPSFRPLLAERMEIVSPPKYYEDVDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaactctatcaatttcccctatgtcccttttcgcgcaagatccggcttctgctc
ggcgaaaagggcgtgggctatgaactggtgcgcgagtcgccctgggagcgccgcgacgag
ttcatcgacctcaacccggcaggccgcacgccggtcatggtcgaccaggagcgcggccag
gtcctgatcgacagcgcggcgatcgcggaatatttcgaggagaccgtcgagacgaaggcg
atgatcaacggcaccgcggcaaaccgcgccgaaattcgccgcctcgtcgcctggttcgac
caggacttttattatgaagtcaccggcccgctgctcttcgagcggatgcaaaagcgcatt
gtccatcgccagccgcccgacgccggtgcgctccgcgaggcgatgaaggcggcgaacaac
catctcgactatgtcgactatctgatcgatcatcgcacctggcttgccggcgcgacgatg
agccttgccgacctcgccgccgcggcgcacatctcggtggccgactatctcggcgggatc
gactggaccggccatgagcagaccaagggctggtattcgggtctcaagtcccgcccgagc
ttccgcccgctgcttgccgagcgaatggagatcgtcagtccgcccaaatattatgaggac
gtcgacttctag

DBGET integrated database retrieval system