KEGG   Sphingopyxis sp. QXT-31: BWQ93_18615Help
Entry
BWQ93_18615       CDS       T04913                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BWQ93_18615
Enzymes [BR:sphq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BWQ93_18615
Transporters [BR:sphq02000]
 Other Transporters
  Pores ion channels [TC:1]
   BWQ93_18615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C GST_N_2 GST_N GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AQA00245
UniProt: A0A1P8X1Y7
LinkDB All DBs
Position
3885840..3886487
Genome map
AA seq 215 aa AA seqDB search
MIIYGSLVSPFVRKLLAYLGEKGLDFELKGVGIGDPDPGFRAASPLGKMPAMDDDGFMLA
DSSAIVQYLEAKHPSPELIPADPQQRGKVIWWEEFGDTVFAACSGKMFFNRIVAPKFLGR
EGDLAAAALAESEELPKLLAYLESAIPASGFLVGDRITLADLAVASPLMNFKHCGACVDA
ATHPKVAAWSAAILARPSFAPWVEKEERMMAKVLA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcatttacggttcgctggtgtcgcctttcgtgcgcaagctgcttgcctatctgggc
gagaaggggctcgatttcgaattgaaaggcgtcggcatcggcgatcccgacccgggattc
cgcgcggcctcgccgctgggcaagatgcccgcgatggacgacgacggcttcatgctcgcc
gattcgagcgcgatcgtccaatatctggaagcgaaacatccctcgcccgaactgatccct
gccgacccgcagcaacgcgggaaagtgatctggtgggaggagttcggcgacacggttttt
gcggcgtgcagcggcaagatgttcttcaaccgcatcgtcgcgccgaaattcctcggccgc
gagggcgatctggccgccgcggcgctggccgagagcgaggaattgcccaagctgctggcc
tatctcgaaagcgcgatccccgcgtcgggtttcctcgtcggcgaccggatcacgctcgcc
gatctcgcggtcgcgtcgccgctgatgaatttcaagcattgcggcgcatgcgtcgacgcg
gcgacgcacccgaaggtcgctgcatggagcgcagcgatattggcgcggccgagctttgca
ccctgggtcgaaaaagaagagcggatgatggcgaaggtgctcgcctga

DBGET integrated database retrieval system