KEGG   Sphingobium sp. TKS: K426_19750Help
Entry
K426_19750        CDS       T04965                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
spht  Sphingobium sp. TKS
Brite
Translation factors [BR:spht03012]
 Eukaryotic Type
  Elongation factors
   K426_19750
 Prokaryotic Type
   K426_19750
Mitochondrial biogenesis [BR:spht03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    K426_19750
Exosome [BR:spht04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   K426_19750
  Exosomal proteins of breast cancer cells
   K426_19750
  Exosomal proteins of colorectal cancer cells
   K426_19750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3981448..3982638)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFVDYANIDKAPEERERG
ITISTAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSATDGPMPQTREHI
LLARQVGVPQLVVFMNKVDLVDDPEILELVELEIRELLSSYDFDGDNIPVIPGSAVKALD
GTNDEIGKQAVLKLMEAVDTFIPQPERPIDKPFLMPIEDVFSISGRGTVVTGRVETGIVK
VGEEVEIVGIKDTRKTTVTGVEMFRKLLDEGRAGDNIGALIRGVGREEVERGQVLAKPGT
ITPHTEFDAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNVK
LGVKLIAPIAMDQGLRFAIREGGRTVGAGVVGTISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaagtttgagcggaccaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacctcgctgaccgcagcgatcaccaaggtgctcgctgaaaccggc
ggcgcgaccttcgttgactatgccaacatcgacaaggctcccgaagagcgcgagcgcggc
atcaccatttcgaccgcccacgtcgaatatgagaccgaagcccgtcactacgcgcacgtc
gactgcccgggtcacgccgactacgtcaagaacatgatcaccggtgcggcccagatggac
ggcgccatcctcgtcgtttcggccaccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgccgcagctcgtcgtattcatgaacaaggtcgacctc
gttgacgatccggaaatccttgagctcgtcgagctggaaatccgcgagctgctgtcgtct
tacgacttcgacggcgacaacatccccgtcatccccggctcggccgtgaaggcgctggac
ggcacgaacgacgaaatcggcaagcaggccgttctgaagctgatggaagcggtcgacacc
ttcatcccgcagccggagcgtccgatcgacaagcccttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtcgtgaccggccgtgtcgaaaccggcatcgtcaag
gttggtgaagaagtcgaaatcgtcggcatcaaggacacccgcaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgacgaaggtcgggcgggcgacaatatcggtgcgctg
atccgtggcgtgggccgtgaagaagtcgagcgcggtcaggttctggccaagcccggcacc
atcaccccgcacaccgagttcgacgccgaagtctacgttttgtcgaaggaagaaggcggc
cgtcacaccccgttctttgcgaactatcgtccgcagttctacttccgcaccaccgacgtg
accggcgaagtgatcctgcccgagggcaccgagatggtcatgccgggcgacaatgtgaag
ctcggcgtcaagctgatcgctccgatcgcgatggaccagggtctgcgcttcgcgatccgc
gaaggcggccggaccgtcggcgcaggggttgtcggcacgatctcgaagtaa

DBGET integrated database retrieval system