KEGG   Sphingomonas sp. KC8: KC8_07055Help
Entry
KC8_07055         CDS       T04987                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
spkc  Sphingomonas sp. KC8
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spkc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    KC8_07055
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    KC8_07055
Enzymes [BR:spkc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     KC8_07055
Peptidoglycan biosynthesis and degradation proteins [BR:spkc01011]
 Precursor biosynthesis
  Racemase
   KC8_07055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1483356..1484510
Genome map
AA seq 384 aa AA seqDB search
MMLNDRDRMTDPDDTADMAGGRLMIDLAALRSNYRQIARHVAPARAAAVVKADAYGLGVR
QAATALAESGCRDFFVAHLGEARALRPILPADARLYVLNGLMPGTEMLCAHAGILPVLNS
VDQAARWREAAQSIGRPLPAVLQFDSGMARLGIDDGEARQLAGDTAFRAHVPLALVMSHL
ACADTLDSPVNAAQIARFDALAGLFPSVPRSFANSGGAFLAPAFHNQIVRPGIALYGGAP
NDAQPNPMRPVIRLDARVIQVRTIAAGGGVGYGHSFHAPHETRIATIAVGYADGLPRSLS
NRGAAWFNGTRLPIAGRVSMDSITLDVTALPEGALKLGDWVELIGPHQSLDRLAQDAGTI
SYEILTSLGARYHRIYRDAADAQA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaacgatcgcgatcggatgacggacccggatgataccgccgacatggcgggt
ggccggctgatgatcgaccttgccgccctgcgcagcaattaccgccagatcgcccgtcat
gtcgcccccgcgcgcgccgccgccgtggtgaaggccgatgcctacgggttgggcgtgcgc
caggccgccaccgcccttgccgaatccggctgccgggatttcttcgtggcgcaccttggc
gaagcacgcgcgcttcgcccgatcctgccggccgacgcgcggctctacgtcctcaacggg
ctgatgcccggcaccgaaatgctttgcgctcatgccggcatattgcccgtgctcaactcg
gtcgatcaggcggcacgctggcgcgaagccgcacaatcgatcggccgccccctgcccgcc
gtcctccagttcgacagcggcatggcccgtcttggcatcgacgatggcgaagcccggcaa
ctggccggggatacggcgttccgcgcccacgtcccgcttgctttggtgatgagccatctt
gcctgcgccgatacgctggatagccccgtcaatgccgcgcaaatagcgcggttcgatgcg
ctggccgggctgttcccgtcggtcccccgctcattcgccaattcgggtggcgcattcctg
gcccccgcctttcacaaccaaatcgtccgccccgggatcgcgctctacggcggcgcgccc
aatgatgcgcagcccaacccgatgcgccccgtcattcggctcgatgcccgcgtcattcag
gtgcggacgatcgcggcgggcggcggcgtcggctatggccacagcttccacgcaccccac
gaaacgcggatcgccacgatcgcggtgggctatgccgatggcctgccgcgcagcttaagc
aatcgcggtgcggcatggttcaatggcacccgcctgccgatcgccggccgcgtgtcgatg
gacagcatcacgctcgacgtgacggcgctgcccgaaggtgcattgaaattgggggattgg
gtcgaactgatcggcccgcaccagtcgctcgataggctcgcgcaggatgcgggcacgatt
tcctacgaaattctcaccagcctcggcgcgcgttatcatcgcatctaccgcgatgccgcc
gacgcccaagcatag

DBGET integrated database retrieval system