KEGG   Shewanella pealeana: Spea_3181Help
Entry
Spea_3181         CDS       T00606                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spl  Shewanella pealeana
Pathway
spl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Spea_3181
Enzymes [BR:spl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Spea_3181
Transporters [BR:spl02000]
 Other Transporters
  Pores ion channels [TC:1]
   Spea_3181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ABV88497
JGI: Spea3181
UniProt: A8H7G0
LinkDB All DBs
Position
complement(3900419..3901042)
Genome map
AA seq 207 aa AA seqDB search
MITLYGIPRSRSLRVSWTLEELGLDWQYHYINFAKGDSRDPAFLAVNPCGKVPALVDDGF
ALTESAAIVLYLAEKYGQGKLLPKVGTHESAQHHKWVSFIISELEQPLWSIGKHKFALPE
EQRLPAMLSVAKWEFDKAAAIAEKWLPESDFLLGDELSIADILLGHTLLWATRFEQDIPP
KLTAYRDRITARPAMAKGLAKEEAGAA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattacactatatgggatcccgcgtagccgctctttgagagtgtcatggaccttagaa
gagttaggactcgactggcaatatcactatatcaactttgccaagggcgacagtcgtgac
cccgcgtttttggccgttaacccttgtggcaaggttccggcgctggtagatgatggtttt
gcattaactgaatcagcagcaatcgtactttatttagctgagaaatatggtcagggtaag
ttgctgccaaaggtggggactcatgagtcggcgcagcatcataagtgggtcagctttatt
atcagtgagcttgagcagccgctgtggagcataggaaaacataagtttgccctgccagag
gaacagcgtcttcctgctatgctatcggttgctaagtgggagtttgacaaggctgcggca
atcgccgaaaagtggttacctgagagtgattttttacttggcgatgagctaagtattgcc
gatatattgcttgggcataccttgctgtgggcgacacgatttgagcaagatattccacca
aaactgaccgcctaccgcgatagaattacggctcgaccagccatggctaagggacttgct
aaagaagaggcgggcgccgcttga

DBGET integrated database retrieval system