KEGG   Serratia plymuthica PRI-2C: Q5A_005810Help
Entry
Q5A_005810        CDS       T04576                                 

Gene name
ppsA_1
Definition
(GenBank) Phthiocerol synthesis polyketide synthase type I PpsA
Organism
sply  Serratia plymuthica PRI-2C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1234396..1242234
Genome map
AA seq 2612 aa AA seqDB search
MPSHQLFNRGFNSFNQLLPELAVRHTDKTAFEFLRSAKEISNQSYRQLHQRAASLASALQ
QYGHRGDRVILLYPDGEDFIGAFFGCLYAGMIAVPVPMPAKASGSAWERFSGVLRNAQTG
FIVTTGKGAETLISLGLPLAPLIFTFDPLPAVALPAGYRLQHLDSHFSGEFNPAPVSDDD
VAFLQYTSGSTGTPKGVMVTHGNLWANSQAIHHYFGHHHESRGMIWLPHFHDMGLIGGLL
QPVFGAFPCRVMSPMMLMKNPLNWLKQVSEYRATTSGGPNFAYDLCVRKISPQQAEGLDL
SCWDVAFCGAEPIRPATLRQFSEHFAPAGFRAQAFLPCYGMAETTLIVTGREKGQGMAVA
EEKAGEVVNCGEALPGTDVRIVDPDTLQPLAAGQTGEIWLRGPSIAAGYWNNPAATEATF
QARIEPDPAHWLRSGDLGFLQAGALYVTGRAKELLIVNGQNHYPTDIEETLRGADILLAD
ATVCVFATEVAETEQAVALLEIPERLRETLDTAALNRRLNAVVAERHGITLGEWVWVGRR
GIPRTTSGKLQRTRAREMYRQNELAVQWRSRAVQPPPAQVADVASYSEPALAALIAGIIG
TAVNGAVGEEQWDEAFTAFGLNSLQAVGVIGELEQHLGRELSPALIYDYPTINKLAAGLL
QPAERPEALAMAVAGQDIAVIGIGVELPGHSGVQALWSMLQQGQSTMGEIPAHRWAGSAL
SGFNRKGSFFDRVSDFDAGYFGISPREAEYIDPQHRLLLETVQQALTDAGLQASALRGSD
TAVFIGISASDYALVSGDRVSAYSGLGNAHSIAANRISYLYDFKGPSVAIDTACSSSLVA
IDGAMQSLRSGRSSLAIAGGVNLALTPHLQKVFTEAQMLAPDGQCKTFDARADGYARGEG
CGIVVLKPLAQALADGDRVYATLVASAINQDGRSNGITAPNGPSQQAVIARALAEAGIDG
NQIDYVEAHGTGTALGDLIEYQALEAVFAERSQPAPVQVGSVKTNIGHLEAAAGVLGVVK
TALMLHGQQRVPHLNFQQKNPHIAAISRRVAVAGSQPCAWESAAGQRYAGVSSFGFGGTN
SHVILRDCPQAAKRDEAAQPLALLLVASHEEQGFSAQRDGIYNTLQMQHDVDVPAWCRLV
NTRYDHPRYRGFAYGANRRQLAENLAQLTANKVEKPRPQVWLFPGQGTQQIGMGAALYQH
LPHYRTRFDSLADTVQERYQIDIRQALHAQDDSWQHCAKTCQLALFACTYATADSLLQFG
LRPAAVIGHSLGEYCAAVVAGQISLDQGLAMVHQRANLMAGLEQQGSMAVVFSGENEVRR
CIAPWADDIDIAAFNTPTLTTITGSSPAIDACLQAISAQGGHARRIKTTNAFHSHLMAPI
LPAYRLWLTQHIDFAEGNIPFYSNLDALPRRHTDADYWSQQIRQPVHFLQGIQALREEGK
YTFVDLSADSSLGKFVAATDRSQPILAAADHRHEYQSLLTLLGSLWQQGHDIDWSRLYRA
TSREALTLPAIQFCRKTYWLADEKPTLPPSSYEDAMSKQHQLRAEIKAIIAGYLGASPEA
LDDDLPFLEMGADSLVLLDAINTIKDRYGVVIPLRSLFEELNTLDAVIHFVVERAQVAEP
EPVASESRVVAVVPQAAASAAPAPPSLIEHEWTMPAAAPDALQGVIARQLEVMSQQLRLL
SGGHAQPLSAPALPSVPASAPVEALPPAAVANNAAATAAPAKAGAHSSWFKKETQKTSLG
AERDNHIQQLTQQFVSKTSGSRHNAQQYRAVLADNRASAGFRLSTKEMLYPLVGVRSQGS
RIWDVDGNEYVDFTMGFGANLLGHAPECVQQAVAAQLAQGMQIGPQSALAGEVATLIAEL
TGQQRVAFCNSGSEAVMSAVRLARAVTGKNKVALFSGSYHGVFDGILGRQQGGETPERAV
PIAAGTTASLVEDLLVLDYGSEESLALIAQYADQLAAVIVEPIQSRYPDHQPRDYLHALR
KLTAERNIALMFDEVITGFRLAAGGAQAYYGVQADIATYGKIVGGGLPIGAIAGSARFMD
SIDGGFWQYGDESWPQSELIFFAGTFSKHPLTMAASKAVLDYIKSHPGLYDDINQKTHYL
AQTLNTWFATTGTPIEIVSAGSLFRFKFSGNYDILFHHLMLRGIFIWEGRNCFVSTAHSS
QDIEHFIAAVKESVNAMRVDGFFGDAGLHPNTPYPAADSQQRFMLLAAKDESGLCAGNIG
CVVETAREIEGSLLAEAWALLSERHESLRMQFNGAGELRVVPGGANVDFIEERSESADLA
ARLAEFAAKPFALTAAPLARVLLLSQPGQTALALSAHHTVADGWSFMVILRELLHIYDAL
AAGFSPELSAAPSYLRFMRAEKTANDAEVAQRLAAIPARRFDPASALPVVLQAAPYQGRR
LKQTLAYPSLSAQLRKVAAELRTTRFVMLNALFVSTLEKFIGGSLLPIAVPDAGRDFESS
EGLVGQCVSLMPLCFNSAESASWPEFVGRVHQAVLAQREAPALPSRCFHGEQAPLPLIAT
FNVEPPAPLAEMRQWQASLSMLPVNAVEFPLMMNVVEMADELSIELDYQARYFTEQTASA
LLEQYLAAIAVLAEQGVSAVNQQFYSPVTVEA
NT seq 7839 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatcagttgtttaacaggggatttaattccttcaaccaactattgcccgag
cttgctgttcgacataccgacaagacggcatttgaatttttgcgaagtgccaaagaaata
agcaaccaaagctacagacaattgcatcagcgcgccgcatctctggccagcgcgcttcag
caatacggtcatcgtggcgatcgggttattttactttatcccgacggcgaagattttatt
ggcgcatttttcgggtgtctttatgccggcatgattgccgttcctgtccctatgccggcc
aaggcctcaggaagtgcgtgggagcgttttagcggggttttacgcaatgcgcaaacggga
tttatcgtcaccacaggaaaaggcgctgaaaccttaatatcgctcggtttaccgctggcg
ccgctaattttcacctttgacccactgcccgcagtggcattgccggcgggataccgcctt
cagcatctcgatagccatttttcaggggagtttaatcctgcaccggttagcgatgacgat
gtggcttttttgcaatatacctcgggttcaaccggtacgccaaaaggggtcatggtcact
catggcaacctgtgggccaactcgcaggccattcatcactattttggtcaccaccatgaa
agccgcggcatgatatggctgccgcatttccatgatatggggcttatcggcggcctgctg
cagccggtattcggggcattcccttgccgggtgatgtcgccgatgatgctgatgaaaaac
ccgcttaactggctaaagcaggtgtcggagtaccgtgcgacgacctcgggcggccctaat
ttcgcctacgatctctgcgtgcgcaaaatcagcccgcagcaggccgaaggcctggatctc
tcctgttgggatgtggcgttttgcggcgcggagccgatccgcccagccacgttgcgccag
ttcagtgaacattttgcccctgccggtttccgggcgcaggcgtttttaccctgctacggc
atggcggaaaccacgctgatcgttaccggcagggagaaaggccaggggatggcggtcgcc
gaagaaaaagcgggggaggtcgtcaactgtggcgaggcgttgcccggcaccgatgtacgc
attgtcgatcccgacactctacaaccgcttgcggccggccaaaccggcgagatctggtta
cgtgggcccagcattgcggccggctattggaataacccggcggcgacagaagccaccttc
caggcgcgtatcgagcccgatccggcgcattggttacgcagtggcgacctgggtttcctg
caagcgggggcgctgtacgtcaccgggcgcgcgaaagagctgttgatcgtcaatgggcaa
aaccattacccgacggacatcgaggaaaccctcaggggagcagatattttgctcgcagac
gcaaccgtttgcgtcttcgccaccgaggttgccgaaacggaacaagcggtagccttgctg
gagatcccggagcgtctcagggagaccctggataccgctgcgttgaaccggcgtttgaat
gccgtggtggccgagcggcacggcattaccctgggggaatgggtgtgggtcggccgccgg
ggcattccacgtacgaccagcggcaaattgcaacgaacccgcgccagagagatgtaccgg
caaaatgagctggcggtgcaatggcgcagccgtgccgtacagcccccaccggcccaggtt
gccgacgttgcctcatacagcgagccggctctggccgcgcttatcgccggtatcatcggc
actgcggtcaacggcgctgtcggtgaagaacagtgggatgaggcctttaccgcctttggc
ctgaactcgttacaggcggttggcgtgatcggcgagttggaacaacatttggggcgcgag
ctgtcgccggcgctgatttacgattatccgacgatcaacaagctggctgcgggtctgttg
caacccgctgagcgaccggaagcacttgcgatggccgtggccggccaggatatcgccgtg
attggcatcggggttgaactgccgggccacagcggcgtgcaggcgctatggtcgatgttg
caacaggggcaaagcaccatgggggaaataccggctcatcgttgggccggctctgcactc
agcggttttaaccgcaaaggcagtttttttgatcgcgtgagcgattttgacgccggttac
tttggtatttcgccgcgtgaggcggagtatatcgatccgcaacatcgcctgctgttggaa
accgtgcaacaggcactgactgatgcgggattacaggcttcggcgctgcggggaagcgat
accgcggtgtttatcggcatcagcgccagtgattatgccctggtctcgggcgaccgggtt
tccgcttatagcgggttgggtaacgcgcacagcattgccgccaaccgcatatcttatctt
tatgattttaaagggcccagcgtcgccatcgataccgcctgttcctcttcgctggtggcc
atcgacggggccatgcaaagcctgcgctcggggcgcagttcgctggccattgccggcggc
gtgaatctggcgctgacgccgcatttgcaaaaggtcttcaccgaggcgcagatgttggca
ccggacggccagtgcaaaacctttgacgcgcgcgccgatggctatgcgcgtggcgagggg
tgcggcatcgtggtgttgaaacccctggcgcaggcattggccgatggtgaccgggtttat
gccaccttggttgccagcgccatcaatcaggatggccgcagcaacggcatcacggcgcct
aacgggccatcgcagcaggcggtgatcgcgcgggcgctggccgaggcgggcatcgacggc
aatcaaatcgactatgtggaggcgcatggcaccgggactgcgctgggtgacctgatcgag
tatcaggcactggaagcggtgtttgccgagcgtagccaaccggcaccggttcaggtgggg
tcggtcaagaccaatatcggccatctcgaagccgccgccggcgtgcttggggtggtgaag
accgcgttgatgctgcatggccaacagcgcgtgcctcatttgaatttccaacaaaaaaat
ccgcatatcgccgccattagccgccgggtggcggtcgcgggaagccagccttgtgcctgg
gaatctgcggcggggcaacgttatgccggcgtcagcagttttggcttcggcgggacgaac
agccacgtgatactgcgtgattgtccacaggccgcgaagcgcgatgaggcggcccagccg
ctggcgctgctgctggtggcctcgcacgaagaacaggggttcagcgcgcagcgtgacggc
atttataacaccttgcaaatgcaacacgacgttgacgtcccggcatggtgtcgcctggtc
aatacccgttatgaccacccgcgctatcgtgggtttgcctatggcgccaaccgccggcaa
ctggcagaaaacctggcgcaactcaccgcgaataaagtggagaaaccgcgcccgcaggtc
tggttgttccccgggcagggaacgcagcaaatcggtatgggagcggctttataccagcac
ctgccgcactaccgcacgcgcttcgatagcctggctgataccgttcaggaacggtatcaa
attgatattcggcaagcgctgcatgcgcaggacgacagttggcagcattgcgccaaaacc
tgccagttggccctgtttgcctgcacttatgccacggcggatagcctgttgcagttcggg
ctacgcccggcggcggtgattggccatagcctgggcgagtattgcgctgcggttgtcgcc
ggccagatttcgctggatcaagggctggcgatggtgcatcagcgtgcaaatctgatggcc
ggcctggagcaacagggctcgatggcggtggtgttcagcggcgaaaacgaggttcgtcgc
tgtatcgccccctgggccgacgatattgatattgccgcgttcaatacgccgacgctgacc
accatcaccggcagttcgccggcgattgatgcctgcctgcaggcgatttcagcgcaaggc
ggccatgcccgccggattaaaaccaccaacgcattccattctcacctgatggctcccatc
ttgccggcgtatcgcctttggttgacgcagcatattgattttgccgaggggaatatccct
ttctacagcaatctggacgctctgccgcgccggcacaccgatgccgattactggagccaa
caaatccggcaacccgttcatttcctgcaaggcatacaggcgctgcgagaggaagggaaa
tatacctttgtggatctgagcgccgacagttcgctgggcaagtttgtcgccgccaccgat
cgcagccaaccgattttggcggccgccgatcatcgccatgaataccaatcactgctgacg
ctgctgggttcgttgtggcagcaagggcatgacatcgactggtccaggctgtatcgcgca
acaagccgcgaggcgttgacgctgccggccatccaattctgtcggaaaacctattggttg
gccgatgaaaagccaacgctgccaccatcttcatacgaggacgctatgtcaaaacaacat
caattacgcgccgaaatcaaagcgatcattgccgggtatttgggggcatcgcccgaagct
ctggatgatgatctgcccttcctggaaatgggggccgattcgctggtcttgctggatgcg
atcaataccatcaaggatcgctatggcgtggtgatcccgctgagatcgctgtttgaagag
ttgaacacgctggatgcggtgatccatttcgttgtggagcgtgcgcaagtggcggagcct
gaacctgtggccagtgaaagccgggttgtggcggtagtgccgcaagccgcagcctcggcg
gcacccgcgccaccctctctgatcgaacacgaatggaccatgccggcagcggcaccggac
gcgttgcaaggggtgattgcacggcaattagaggttatgtcgcaacagctgcgcctgttg
agcggcggccatgctcaaccgctttcagcacccgcgctgccttcggtgccggcaagtgcg
ccggtagaagcacttcctccagcggccgtggcgaataacgcggcggccaccgctgcaccg
gccaaagccggcgcccacagtagctggtttaaaaaggaaacccaaaagacctcattgggg
gccgagcgcgataaccatatacagcaactgacgcagcagtttgtcagcaaaacctctggc
tccaggcacaatgcgcagcagtaccgcgccgtgctggcagataaccgggcatcggcaggt
tttcgtttatccaccaaggaaatgctgtacccactggtgggcgtgcgttcacaaggctcc
cgtatttgggatgtcgacggtaacgagtacgttgatttcaccatggggtttggtgccaac
ctgttggggcatgcaccggagtgcgtgcagcaggccgttgccgcacagctggcgcaaggc
atgcaaatcgggccgcagagcgctctggccggtgaagttgcgacattgatagcggagctg
acgggccagcagcgcgtggctttctgtaactccggttctgaagccgtcatgagcgcggtg
cgcctggcgcgggccgtaacgggcaagaataaagtggcgctgttcagtggctcttatcac
ggcgttttcgatggcatcctggggcgccaacaggggggcgaaaccccggagcgggcagtg
ccgatcgccgcaggaacgacggcgtccctggtcgaggatctgctggtgctcgactacggc
agcgaagaaagcctggctttgattgcccagtatgccgatcaactggctgcggtcattgtg
gagccgatacaaagccgctatcccgatcatcagccgcgcgactatttgcatgcgctgcgt
aagctgacggccgaacgcaatatcgccttgatgttcgatgaagtgattaccggtttccgc
ctggctgccggcggcgcgcaggcgtattacggtgtccaggccgatattgccacctacggc
aagattgtcggcggcggcctgccgattggcgccattgcggggtcggcgcgctttatggac
agcattgacggcggtttctggcaatacggcgatgagtcctggccgcaatccgaactgatt
ttctttgccgggaccttctccaaacaccccctgaccatggcggccagcaaagcggtgctc
gactatatcaagagccaccccgggctatatgacgacatcaaccaaaagacgcattacctc
gcgcaaacgctcaacacctggtttgccacgacgggcacgcctatcgagatcgtttcggcg
ggcagtttgttccgtttcaaattcagcggtaactacgacattctgttccatcacctgatg
ctgcgcggcatctttatttgggaaggccgcaactgcttcgtgtccaccgcgcactcttcg
caagacatcgagcactttatcgcggcggtaaaagagagcgttaatgccatgcgcgttgac
ggcttctttggtgacgccggtttgcaccccaatacgccttacccggccgccgacagccag
cagcgttttatgctgctggccgccaaagacgaaagcgggctgtgcgcgggcaacattggc
tgcgtggttgaaacggcgcgtgaaatcgagggatcacttctggccgaagcctgggcgctg
ctgagcgaacgtcatgagtccttgcgcatgcagttcaacggcgcgggggagttgcgggtg
gttccgggcggggccaatgtcgattttattgaagaacgcagcgagtcggcagatctcgct
gcccggctggccgagtttgccgctaaacccttcgcattgacggccgcgccgctggcgcgc
gttttgttgctgagccagcccggccaaacggccctggcgttgtcggcgcaccatacggtg
gcggatggctggtcattcatggtgatactgcgtgaactgctgcatatctacgatgcgctg
gcggcagggtttagccctgagctgtcggcggcaccgagctatctgcgttttatgcgtgcg
gaaaagacggccaatgatgccgaggttgctcaacggctggccgctattccagcgcgtcgt
ttcgatcccgccagtgcgctgccggtggttttgcaagcagcaccctatcaaggccggcgt
ttgaaacagaccctggcttacccgagtttgtcggcccaactgcgtaaagttgccgcagaa
ctgcgtaccactcgctttgtgatgttgaacgctctgtttgtatcgacgctcgagaagttt
atcggcggctctctgttgccgatcgccgtgccggatgccggacgtgacttcgagagcagc
gaagggctggtcggccaatgcgtcagcctgatgccgctgtgcttcaacagtgccgagagc
gcttcgtggccagagtttgtcggcagggtgcatcaggcggtgctggcgcagcgtgaggct
ccggcattgccgtcccgctgtttccatggcgagcaggcgccactgcctctgattgccacg
ttcaatgtcgaaccgcctgcgccgttggcggaaatgcgccagtggcaggccagcctgtcg
atgctgccggtcaacgcggtcgaattccccttgatgatgaacgtggtggaaatggccgac
gagctgtcgattgaacttgattatcaggcgcgttatttcaccgagcaaaccgcctcagcg
ctactggagcagtatctggctgcgatcgcggttctggcagaacaaggtgtgagcgcagta
aatcagcagttttattcaccggttaccgtggaagcatga

DBGET integrated database retrieval system