KEGG   Serratia plymuthica PRI-2C: Q5A_024165Help
Entry
Q5A_024165        CDS       T04576                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sply00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q5A_024165 (glpD)
Enzymes [BR:sply01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Q5A_024165 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5161552..5163060
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVEVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYHGDPKDVKIDDNEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDDQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGDIGGDRDSYAAKLRREHGWLPESLARRYART
YGSHSELILANANGLDDLGEEFGHGLYEAELRYLVEKEWVVELEDAIWRRTKLGMWLDDA
QQARVKAWLAEHTKTKTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtccgtactgctactggaagcgcaagacttggcctgcgct
acgtcttccgccagttccaaattgatccacggcggcctgcgctacctggaacactacgaa
ttccgtctggtgagcgaagcgctggccgagcgtgaagtattgctgaagctggcgccgcac
atcgcgtttcccatgcgttttcgcctgccgcaccagccgcatctgcgcccggcctggatg
atccgcatcggcctgttcctgtacgatcacctgggtaaacgcaccagcctgccgggcagc
aagagtttgcgctttggaccagaatcggtactgaagcctgagttaaagcgcggtttcgaa
tattccgactgctgggtggacgatgcccgcctggtggtgctgaacgcgcaggaagtcgaa
aaacgcggcggcgaagtgcgcacccgtaccaaagtgacccgtgcttggcgtgaaaatggc
ctgtggatggtggaagcggttgaggtcgacagcggtaaaacctttacctggcgcgccaag
ggcctggtcaatgccaccggtccttgggtgaaacacttcttcgacgacggcctgaagctg
aaatcaccgtacggcatccgcctgatcaaaggcagccatatcgtggtaccgcgcgctcac
aaccagccgcagtcctatattctgcaaaacgaagaccatcgcatcgtgttcgtcatcccg
tggaatgacgagttctcgattatcggcaccaccgacgtggaataccacggcgatccgaaa
gacgtgaaaatcgacgacaacgagatcgactacctgctgaaagtgtacaacgaccacttc
aagaagcagttgggccgtgacgacatcgtctggacatactccggtgtgcgtccgctgtgc
gatgacgaatctgattcgccacaggcggtgacccgcgactacacgttggatgtgcatgac
gatcagggcaaagcgccgctgctgtcggtattcggcggtaaactgaccacctaccgcaag
ctggctgagcatgcgatggaaaaactggcgcactactaccctggctgcggcccggcgtgg
accaaaaacggttcgctgcccggcggcgacatcggtggcgatcgcgacagctacgccgcc
aaactgcgccgcgagcacggctggttaccggaatccctggcgcgccgctacgcccgcacc
tacggtagccacagcgagctgatcctggcgaatgccaacggccttgacgatctgggcgaa
gagtttggccacggcctgtatgaagccgaactgcgctatctggtagagaaagagtgggtg
gtcgagctggaagacgccatctggcgccggaccaagctgggcatgtggctggatgatgcg
cagcaggcgcgggtgaaagcctggctggcggaacacacgaaaacgaaaacgctctctctg
gcatcctga

DBGET integrated database retrieval system