KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1871Help
Entry
spyM18_1871       CDS       T00079                                 

Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
spm00473  D-Alanine metabolism
spm01100  Metabolic pathways
spm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    spyM18_1871
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    spyM18_1871
Enzymes [BR:spm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     spyM18_1871
Peptidoglycan biosynthesis and degradation proteins [BR:spm01011]
 Precursor biosynthesis
  Racemase
   spyM18_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAL98379
UniProt: Q8NZK4
LinkDB All DBs
Position
complement(1549784..1550884)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYGHGAVQVSKALLPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELKLAITRQVTVTVASLEWLAMAKQEWPD
LKGLKVHIKIDSGMGRIGLRSVTEVDNLIAGLKSMGADVEGIFTHFATADEADDTKFNQQ
LQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIVSYGLNPSGSDLSLPFPLQ
EALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIGYADGWTRNMQGFSVLVDGQ
FCEIIGRVSMDQLTIRLSKAYPLGTKVTLIGSNQQKNISTTDIANYRNTINYEVLCLLSD
RIPRIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttccatcgcccaacagttgcaagggtcaacttacaagctattaaggag
aatgttgccagtgttcaaaagcatattccactaggggtaaaaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcactcctacctcaagtggat
gggtactgtgtgtcaaatcttgatgaggctttgcaattacgtcaagcaggtattgataaa
gagattttaattcttggggttttgctgccaaatgagctaaagttggcgattactcgccag
gttacagtgacagtggctagtttagagtggctggcgatggccaagcaagaatggccagat
ttgaaagggcttaaggtccatatcaaaattgattcaggcatgggacgaatcgggcttcgc
tcagtaacagaagttgataatctgattgctggcttgaagagcatgggtgctgatgtagaa
ggtatttttactcattttgccacagctgatgaggcagatgatactaaatttaaccagcag
ttacagttttttaaaaagctaatagctggacttgaggataagcctcgtttagtacatgct
agtaattcagccacaagtatctggcatagtgataccatttttaatgctgttcgtttagga
attgtcagttatggtttgaatccaagtggttctgatctaagcttaccatttccactgcaa
gaggctttatctctagaatctagcttagtgcatgtcaagatgatttcagctggtgataca
gtcggttatggagctacttatactgccaaaaagtctgaatatgtagggaccgtcccaatc
ggttatgcagatggctggaccaggaacatgcaaggcttttcggtgttagttgatggacaa
ttctgtgaaattatagggcgtgtatcgatggatcaactgaccatacgactttccaaagca
tatcctttaggaacaaaagtcactttgattggcagcaatcagcaaaaaaatatttctaca
acagatatcgcaaattaccgtaatacaatcaattatgaagttctatgccttttaagtgac
cgtattcctcggatatattaa

DBGET integrated database retrieval system