KEGG   Streptococcus pneumoniae SPN994038: SPN994038_14690Help
Entry
SPN994038_14690   CDS       T02630                                 

Gene name
nanB
Definition
(GenBank) sialidase B precursor (neuraminidase B)
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
spnm  Streptococcus pneumoniae SPN994038
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spnm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPN994038_14690 (nanB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPN994038_14690 (nanB)
Enzymes [BR:spnm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPN994038_14690 (nanB)
Bacterial toxins [BR:spnm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPN994038_14690 (nanB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1494975..1497068)
Genome map
AA seq 697 aa AA seqDB search
MNKRGLYSKLGISVVGISLLMGVPTLIHANELNYGQLSISPIFQGGSYQLNNKSIDISSL
LLDKLSGESQTVVMKFKADKPNSLQALFGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQ
KGINYLFSRPASLWGKHKGQAVENTLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNI
NGIDKATLGAVNREGKEHYLAKGSIGEISLFNKAISDQEVSNIPLSNPFQLIFQSGDSTQ
ANYFRIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFND
YEEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADS
GFKEINGHYYLKLKKNGDNDFRYTVRENGVVYDETTNKPTNYTINDKYEVLEGGKSLTVE
QYSVDFDSGSLRERHNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPF
LGEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFKNATA
EAQMVELRDGVIRTFFRTTTGKIAYMTSRDSGETWSEVSYIDGIQQTSYGTQVSAIKYSQ
LIDGKEAVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELP
NHHIGVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagaggtctttattcaaaactaggaatttctgttgtaggcattagtctttta
atgggagtccccactttgattcatgcgaatgaattaaactatggtcaactgtccatatct
cctatttttcaaggaggttcatatcaactgaacaataagagtatagatatcagctctttg
ttattagataaattgtctggagagagtcagacagtagtaatgaaatttaaagcagataaa
ccaaactctcttcaagctttgtttggcctatctaatagtaaagcaggctttaaaaataat
tacttttcaattttcatgagagattctggtgagataggtgtagaaataagagacgcccaa
aagggaataaattatttattttctagaccagcttcattatggggaaagcataaaggacag
gcagttgaaaatacactagtatttgtatctgattctaaagataaaacatacacaatgtat
gttaatggaatagaagtgttctctgaaacagttgatacatttttgccaatttcaaatata
aatggtatagataaggcaacactaggagctgttaatcgtgaaggtaaggaacattacctc
gcaaaaggaagtattggtgaaatcagtctatttaacaaagcaattagtgatcaggaagtt
tcaaatattcccttgtcaaatccatttcagttaattttccaatcaggagattctactcaa
gctaactattttagaataccgacactatatacattaagtagtggaagagttctatcaagt
attgatgcacgttatggtgggactcatgattctaaaagtaagattaatattgccacttct
tatagtgatgataatgggaaaacgtggagtgagccaatttttgctatgaagtttaatgac
tatgaggagcagttagtttactggccacgagataataaattaaagaatagtcaaattagt
ggaagtgcttcattcatagattcatccattgttgaagataaaaaatctgggaaaacgata
ttactagctgatgttatgcctgcgggtattggaaataataatgcaaataaagccgactca
ggttttaaagaaataaatggtcattattatttaaaactaaagaagaatggagataacgat
ttccgttatacagttagagaaaatggtgtcgtttatgatgaaacaactaataaacctaca
aattatactataaatgataagtatgaagttttggagggaggaaagtctttaacagtcgaa
caatattcggttgattttgatagtggctctttaagagaaaggcataatggaaaacaggtt
cctatgaatgttttctacaaagattcgttatttaaagtgactcctactaattatatagca
atgacaactagtcagaatagaggagagagttgggaacaatttaagttgttgcctccgttc
ttaggagaaaaacataatggaacttacttgtgtcctggacaaggtttagcattaaaatca
agtaacagattgatttttgcaacatatactagtggagaactaacctatctcatttctgat
gatagtggtcaaacatggaagaaatcctcagcttcaattccgtttaaaaatgcaacagca
gaagcacaaatggttgaactgagagatggtgtgattagaacattctttagaaccactaca
ggtaagatagcttatatgactagtagagattctggagaaacatggtcggaagtttcgtat
attgatggaatccaacaaacttcatatggcacacaagtatctgcaattaaatactctcaa
ttaattgatggaaaagaagcagtcattttgagtacaccaaattctagaagtggccgtaag
ggaggtcaattagttgtcggtttagtcaataaagaagatgatagtattgattggaaatac
cactatgatattgatttgccttcgtatggttatgcctattctgcgattacagaattgcca
aatcatcacataggtgtactgtttgaaaaatatgattcgtggtcgagaaatgaattgcat
ttaagcaatgtagttcagtatatagatttggaaattaatgatttaacaaaataa

DBGET integrated database retrieval system