KEGG   Streptococcus pneumoniae SPN034183: SPN034183_14650Help
Entry
SPN034183_14650   CDS       T02629                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu00473  D-Alanine metabolism
spnu00550  Peptidoglycan biosynthesis
spnu01100  Metabolic pathways
spnu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPN034183_14650 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPN034183_14650 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SPN034183_14650 (ddlA)
Enzymes [BR:spnu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPN034183_14650 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:spnu01011]
 Precursor biosynthesis
  Amino acid ligase
   SPN034183_14650 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CCP33175
LinkDB All DBs
Position
complement(1489420..1490463)
Genome map
AA seq 347 aa AA seqDB search
MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEFSHAPGQ
EDRLMTNETIDWDKKVAPSAIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGCNILS
SSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFTKPSNMGSSVG
ISRSENQEELRQALKLAFRYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAFY
DYDAKYIDNKVTMDIPAKISDDVVAVMRQNAETAFRAIGGLGLSRCDFFYTDKGEIFLNE
LNTMPGFTQWSMYPLLWDNMGISYPELIERLVDLAKESFDKREAHLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacgattattcttttatatggtggacggagtgcggaacgcgaagtctctgtc
ctttcagctgagagtgtcatgcgtgcggtcaattacgaccgtttcacagtcaagactttc
tttatcagtcagtcaggtgactttatcaaaacgcaggaatttagtcatgctccggggcaa
gaagaccgtctcatgaccaatgaaaccattgattgggataagaaagttgcaccaagtgct
atctacgaagaaggtgcagtggtctttccagtccttcacgggccaatgggagaagatggc
tctgttcaaggattcttggaagttttgaaaatgccttacgttggttgcaacattttgtca
tcaagtcttgccatggataaaatcacgactaagcgtgttctggaatctgctggtattgcc
caagttccttatgtggctatcgttgaaggcgatgatgtgactgctaaaatcgctgaagtg
gaagaaaaattggcttatccagtcttcactaagccgtcaaacatggggtctagtgtcggt
atttctaggtctgaaaaccaagaagaactccgtcaagccttaaaacttgccttccgatat
gacagccgtgtcttggttgagcaaggagtgaatgcccgtgaaattgaggttggcctcttg
ggtaactacgatgtcaagagcacgctacctggagaagttgtcaaggacgttgccttttat
gactacgatgccaagtatattgataacaaggttactatggatattcctgccaaaatcagt
gatgatgtggtggctgtcatgcgtcaaaatgcagaaacagccttccgtgccattggtggc
cttggtctatctcgttgcgatttcttctatacagataagggagagatttttctcaacgag
ctcaataccatgccaggttttacccagtggtctatgtacccactactttgggacaatatg
gggatcagctacccagaactaatcgagcgtttggttgaccttgccaaggaaagttttgac
aagcgcgaagcgcatttgatataa

DBGET integrated database retrieval system