KEGG   Spongiibacter sp. IMCC21906: IMCC21906_02339Help
Entry
IMCC21906_02339   CDS       T03945                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spoi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IMCC21906_02339
   00620 Pyruvate metabolism
    IMCC21906_02339
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC21906_02339
  Energy metabolism
   00680 Methane metabolism
    IMCC21906_02339
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    IMCC21906_02339
Enzymes [BR:spoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     IMCC21906_02339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2492522..2493502
Genome map
AA seq 326 aa AA seqDB search
MKQPVRVTVTGAAGQIGYALLFRIASGSMLGEDQPVILQLLDITPALDALQGVKMELEDC
AFPLLAGVVCTDDPNVGFKDSDYALLVGARPRGPGMERKDLLEANAAIFSVQGKAIDQNA
SKDIRVLVVGNPANTNALITQRNAPSIPARNFTAMTRLDHNRAMTQIAQKTGKTVNDVTN
MTIWGNHSATQYPDLFNAKVDGKTASDLVDQAWLESDFIPTVQQRGAAIIKARGASSAAS
AANAAIDHMRSWALGTEGDDWVSMGVYSDGSYGIAEGLIYSFPCRCKDGQWEIVQGVEVN
EFSRGKMDATAQELTEERDGVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacccgttcgcgtcaccgttacaggtgcagccggccagattggctacgctctt
cttttccgcatcgcctccggttccatgctgggcgaagaccaacccgttattttacaactg
ctggacatcactcctgctcttgacgccctgcaaggcgtgaaaatggagctggaagattgc
gcattcccactgctggccggtgttgtttgcactgacgatcccaatgttggttttaaagac
tctgattatgctctgcttgttggtgcccgccctcgcggtcccggcatggagcgtaaagac
ctgctagaagccaacgcagcgatcttctcggtacaaggcaaagccattgaccaaaacgcc
agcaaagacatccgcgtattggttgtcggcaacccagccaacaccaacgccctgattact
cagcgcaacgcaccgtctattcctgctcgcaacttcaccgcaatgactcgccttgatcac
aaccgcgccatgacgcaaattgcccagaaaaccggcaaaaccgtcaatgacgtcaccaac
atgaccatctggggcaaccactctgccactcagtatccagacctgttcaatgctaaagtc
gatggcaaaacagcatctgacctcgttgatcaagcctggctggaaagcgacttcatcccc
actgttcaacagcgtggcgcggcgatcatcaaagcacgtggcgcctcttctgccgcctct
gctgccaatgctgccattgaccatatgcgcagctgggcactgggcaccgaaggtgacgac
tgggtatcaatgggcgtttacagtgacggcagctacggcatcgccgaaggcctgatctac
tctttcccttgccgctgcaaagacggtcagtgggaaatcgttcaaggtgttgaagtaaat
gagttcagccgcggtaaaatggacgcgacagctcaagaactgaccgaagagcgtgacggt
gttaagcaccttctgccctaa

DBGET integrated database retrieval system