KEGG   Streptococcus pneumoniae P1031: SPP_1704Help
Entry
SPP_1704          CDS       T00874                                 

Definition
(GenBank) sialidase B (Neuraminidase B)
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPP_1704
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPP_1704
Enzymes [BR:spp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPP_1704
Bacterial toxins [BR:spp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPP_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1579549..1581642)
Genome map
AA seq 697 aa AA seqDB search
MNKRGLYSKLGISVVGISLLMGVPTLIHANELNYGQLSISPIFQGGSYQLNNKSIDISSL
LLDKLSGESQTVVMKFKADEPNSLQALFGLSNSKADFKNNYFSIFMRDSGEIGVEIRDAQ
KGINYLFSRPASLWGKHKGQAVENTLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNI
NGIDKATLGAVNREGKEHYLAKGSIDEISLFNKAISDQEVSTIPLSNPFQLIFQSGDSTQ
ANYFRIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFND
YEEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADS
GFKEINGHYYLKLKKNGDNDFRYTVRENGVVYNETTNKPTNYTINDKYEVLEGGKSLTVE
QYSVDFDSGSLRERHNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPF
LGEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFKNATA
EAQMVELRDGVIRTFFRTTTGKIAYMTSRDSGETWSKVSYIDGIQQTSYGTQVSAIKYSQ
LIDGKEAVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELP
NHHIGVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagaggtctttattcaaaactaggaatttctgttgtaggcattagtctttta
atgggagttcccactttgattcatgcgaatgaattaaactatggtcaactgtccatatct
cctatttttcaaggaggttcatatcaactgaacaataagagtatagatatcagctctttg
ttattagataaattgtctggagagagtcagacagtagtaatgaaatttaaagcagatgaa
ccaaactctcttcaagctttgtttggcctatctaatagtaaagcagactttaaaaataat
tacttttcaattttcatgagagattctggtgagataggtgtagaaataagagacgcccaa
aagggaataaattatttattttccagaccagcttcattatggggaaaacataaaggacag
gcagttgaaaatacactagtatttgtatctgattctaaagataaaacatacacaatgtat
gttaatggaatagaagtgttctctgaaacagttgatacatttttgccaatttcaaatata
aatggtatagataaggcaacactaggagctgttaatcgtgaaggtaaggaacattacctc
gcaaaaggaagtattgatgaaatcagtctatttaacaaagcaattagtgatcaggaagtt
tcaactattcccttgtcaaatccatttcagttaattttccaatcaggagattctactcaa
gctaactattttagaataccgacactatatacattaagtagtggaagagttctatcaagt
attgatgcacgttatggtgggactcatgattctaaaagtaagattaatattgccacttct
tatagtgatgataatgggaaaacgtggagtgagccaatttttgctatgaagtttaatgac
tatgaggagcagttagtttactggccacgagataataaattaaagaatagtcaaattagt
ggaagtgcttcattcatagattcatccattgttgaagataaaaaatctgggaaaacgata
ttactagctgatgttatgcctgcgggtattggaaataataatgcaaataaagccgactca
ggttttaaagaaataaatggtcattattatttaaaactaaagaagaatggagataacgat
ttccgttatacagttagagaaaatggtgtcgtttataatgaaacaactaataaacctaca
aattatactataaatgataagtatgaagttttggagggaggaaagtctttaacagtcgaa
caatattcggttgattttgatagtggctctttaagagaaaggcataatggaaaacaggtt
cctatgaatgttttctacaaagattcgttatttaaagtgactcctactaattatatagca
atgacaactagtcagaatagaggagagagttgggaacaatttaagttgttgcctccgttc
ttaggagaaaaacataatggaacttacttatgtcccggacaaggtttagcattaaaatca
agtaacagattgatttttgcaacatatactagtggagaactaacctatctcatttctgat
gatagtggtcaaacatggaagaaatcctcagcttcaattccgtttaaaaatgcaacagca
gaagcacaaatggttgaactgagagatggtgtgattagaacattctttagaaccactaca
ggtaagatagcttatatgactagtagagattctggagaaacatggtcgaaagtttcgtat
attgatggaatccaacaaacttcatatggcacacaagtatctgcaattaaatactctcaa
ttaattgatggaaaagaagcagtcattttgagtacaccaaattctagaagtggccgtaag
ggaggtcaattagttgtcggtttagtcaataaagaagatgatagtattgattggaaatac
cactatgatattgatttgccttcgtatggttatgcctattctgcgattacagaattgcca
aatcatcacataggtgtactgtttgaaaaatatgattcgtggtcgagaaatgaattgcat
ttaagcaatgtagttcagtatatagatttggaaattaatgatttaacaaaataa

DBGET integrated database retrieval system