KEGG   Streptococcus pneumoniae R6 (avirulent): spr1343Help
Entry
spr1343           CDS       T00060                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Brite
Translation factors [BR:spr03012]
 Eukaryotic Type
  Elongation factors
   spr1343 (tuf)
 Prokaryotic Type
   spr1343 (tuf)
Mitochondrial biogenesis [BR:spr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    spr1343 (tuf)
Exosome [BR:spr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   spr1343 (tuf)
  Exosomal proteins of breast cancer cells
   spr1343 (tuf)
  Exosomal proteins of colorectal cancer cells
   spr1343 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-GeneID: 934560
NCBI-ProteinID: NP_358936
UniProt: P64031
LinkDB All DBs
Position
complement(1326964..1328160)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGIV
KVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtactatcggacac
gttgaccacggtaaaactaccctaactgcagctatcacaactgttttggcacgtcgcttg
ccttcatcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagaacgc
gaacgcggtatcactatcaacactgcgcacgttgagtacgaaactgaaaaacgtcactac
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgct
caaatggacggagctatccttgtagtagcttcaactgacggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
gttgacttggttgacgacgaagaattgcttgaattggttgaaatggaaatccgtgaccta
ttgtcagaatacgacttcccaggtgacgatcttccagttatccaaggttcagcacttaaa
gctcttgaaggtgactctaaatacgaagacatcgttatggaattgatgaacacagttgat
gagtatatcccagaaccagaacgtgacactgacaaaccattgcttcttccagtcgaggac
gtattctcaatcactggacgtggtacagttgcttcaggacgtatcgaccgtggtatcgtt
aaagtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactcaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgctggagataacgtaggt
gtccttcttcgtggtgttcaacgtgatgaaatcgaacgtggacaagttatcgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtctacatccttactaaagaagaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtactact
gacgttacaggttcaatcgaacttccagcaggtactgaaatggtaatgcctggtgataac
gtgacaatcgacgttgagttgattcacccaatcgccgtagaacaaggtactacattctct
atccgtgagggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system