KEGG   Streptomyces pristinaespiralis: SPRI_1371Help
Entry
SPRI_1371         CDS       T04073                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00250  Alanine, aspartate and glutamate metabolism
spri00410  beta-Alanine metabolism
spri00640  Propanoate metabolism
spri00650  Butanoate metabolism
spri01100  Metabolic pathways
spri01120  Microbial metabolism in diverse environments
Module
spri_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spri00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPRI_1371
   00650 Butanoate metabolism
    SPRI_1371
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPRI_1371
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPRI_1371
Enzymes [BR:spri01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SPRI_1371
Amino acid related enzymes [BR:spri01007]
 Aminotransferase (transaminase)
  Class III
   SPRI_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALC19677
UniProt: A0A0M4D6J8
LinkDB All DBs
Position
complement(1608470..1609750)
Genome map
AA seq 426 aa AA seqDB search
MTDLYERHRAVIPDWVALYYKQPIEITHGEGRHVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRLIHSSTLYLNRPMVELAERIAALSGIPDARVFFTTSGTEANDTALLLAT
GHRRSNQILAMRNSYHGRSFSAVSITGNHAWSPTSLSPLQTLYVHGGVRSRGPFAHLSDA
QFVEACVADLEDLLGHTHDVAALIAEPVQGVGGFTSPPDGLYAAFREVLDRHGILWISDE
VQTGWGRTGEHFWGWQAHAENGPPDILTFAKGIGNGMSIGGVVARAEIMNCLDANSISTF
GGSPVTMAAGVANLSYLLEHDLQGNARRVGGLLIERLRGIAASVPAVREVRGRGLMIGIE
LVEPGTDEADPQAAAAVLEAAREGGLLIGKGGGHNTSVLRIAPPLSLTVAEAEEGALVME
RALRRL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctctacgagcggcaccgtgccgtcatccccgactgggtggcgctctactac
aagcagccgatcgagatcacccacggcgaaggacgccatgtgtgggacgcggacggcaac
cgctacctggacttcttcggcggcatcctcaccaccatgaccgcgcacgcgctgcccgag
gtcaccaaggcggtgagcgagcaggccgggcggctcatccactcctccaccctctacctc
aaccgccccatggtggagctcgcggaacggatcgccgccctgtcgggcatcccggacgcc
cgcgtcttcttcaccacctccggcacggaggccaacgacaccgccctgctcctcgccacc
ggccaccgccgttccaaccagatcctggcgatgcgcaacagctaccacggcaggtcgttc
tccgcggtctcgatcaccggcaaccacgcctggtcgccgaccagcctctcgccgctccag
acgctgtacgtgcacggcggtgtccgcagccgcggtcccttcgcccacctctccgacgcg
cagttcgtcgaggcgtgcgtcgccgacctcgaggacctgctcggacacacccacgacgtg
gccgcgctgatcgcggagccggtacagggcgtcggcggcttcacctcaccgcccgacggc
ctgtacgccgccttccgcgaggtcctggaccggcacggcatcctgtggatctccgacgag
gtgcagaccggctggggacgcaccggcgagcacttctggggctggcaggcccacgcggag
aacggcccgccggacatcctgaccttcgccaagggcatcggcaacggcatgtcgatcggc
ggcgtcgtcgcccgcgcggagatcatgaactgcctcgacgcgaactccatctccaccttc
ggcggcagtcccgtcaccatggccgccggcgtcgccaacctctcctacctcctggagcac
gacctccagggcaacgcccgccgggtcggcggcctgctgatcgagcggctgcgcggcatc
gcggcgagcgtccccgcggtgcgggaggttcgcggccggggactcatgatcggcatcgaa
ctggtcgaaccgggcaccgacgaggccgacccgcaggcggccgctgccgtcctcgaggcg
gcacgcgagggcgggctgctgatcggcaagggcggcggccacaacaccagcgtcctgcgc
atcgccccaccgctctcgctgaccgtcgcggaggcggaggagggcgccctggtcatggaa
cgagctctgcgccgcctgtag

DBGET integrated database retrieval system