KEGG   Streptomyces pristinaespiralis: SPRI_4413Help
Entry
SPRI_4413         CDS       T04073                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00620  Pyruvate metabolism
spri00680  Methane metabolism
spri01100  Metabolic pathways
spri01120  Microbial metabolism in diverse environments
spri01200  Carbon metabolism
Module
spri_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spri00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPRI_4413
  Energy metabolism
   00680 Methane metabolism
    SPRI_4413
Enzymes [BR:spri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPRI_4413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALC22719
UniProt: A0A0M3QJ71
LinkDB All DBs
Position
5116896..5119625
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPTASAELRADIRRLGDLLGETLVRQEGPELLDLVERVRALTRTDGEAAAELLG
DTDLETAAKLVRAFSTYFHLANVTEQVHRGHEMRARRAAEGGLLAITADRLKDADPQHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAELLESPVIAADRRRHDLRLAEHIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLAAELERVGVELPPGTRPLTFGTW
IGGDRDGNPNVTPAVTWEVLILQHEHGITDAIEVIDYLRGLLSNSIRYAGATEELLASLQ
TDLERLPEISPRYKRLNAEEPYRLKATCIRQKLVNTRERLAKGTPHEDGRDYLGTAELIA
DLTLIQTSLREHRGGLFADGRMDRVIRTLSAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGQKTLGVFHTVKEAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADVILEGML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRHGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAATL
QASALHTAPRQSDEALSRWDAAMDTVSDAAHAAYRRLVEDPDLPAYFFAATPVDQLAELH
LGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLAEMH
GNWHFFRNFIANVEMTLAKTDLRIARHYVDTLVPENLKHVFEVIEAEHALTVSEVLKVTG
NDELLGSNPVLQQTFAIRDAYLDPISYLQVALLKRQRDAAERGEEADPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccccaccgccagtgcagaactgcgtgccgacatccgccga
ctgggcgatcttctcggcgagaccctcgtccgccaggagggcccggaacttctcgacctc
gtcgagcgggtccgcgccctgacacgcaccgacggtgaggccgccgccgagctgctgggc
gacaccgacctggagaccgcggccaagctggtccgcgccttctccacgtacttccacctc
gccaacgtcaccgagcaggtgcaccggggccacgagatgcgcgcgaggcgcgccgcggag
ggcggactcctcgccatcaccgccgaccggctcaaggacgcggacccgcagcacctgcgc
gagaccgtgaagaacctgaacgtacggcccgtcttcaccgcccacccgacggaggccgcc
cggcgctccgtgctcaacaagctccgccgcatcgccgagctgctggagagcccggtcatc
gcggccgaccgtcgccgccacgaccttcggctcgccgagcacatcgacctgatctggcag
accgacgagctgcgggtcgtccgccccgagcccgccgacgaggcccgcaacgccatctac
tacctcgacgagctgcacgccggcgccgtcggcgacgtcctggaggacctcgccgccgag
ctcgagcgggtcggcgtcgagctgccccccggcacccgcccgctcaccttcggcacctgg
atcggcggcgaccgcgacggcaacccgaacgtcacccccgccgtcacctgggaggtgctg
atcctccagcacgagcacggcatcaccgacgccatcgaggtcatcgactacctccgcggc
ctgctgtcgaactcgatccgctacgccggagccaccgaggaactgctcgcctcactgcag
accgacctcgagcggctgcccgagatcagcccccgctacaagcgcctcaacgcggaggag
ccgtaccggctcaaggccacctgcatccgccagaagctcgtcaacacccgcgagcgcctc
gccaagggcacgccccacgaggacggccgcgactacctgggcaccgccgagctcatcgcg
gacctcaccctgatccagacgtccctgcgcgagcaccgcggcggcctcttcgccgacggc
cgcatggaccgggtcatccgcaccctgtccgcgttcggcctccagctcgccaccatggac
gtccgcgagcacgccgacgcccaccaccacgcgctcggccagctcttcgaccggctcggc
gaggagtcgtggcggtacgcggacatgccgcgcgactaccggcagaagcttctcgccaag
gaactccgctcccggcgccccctcgcgccgaccccggcaccgctggacgccgcgggacag
aagaccctcggcgtcttccacacggtcaaggaggccttcgagcggttcggccccgaggtc
atcgagtcgtacatcatctcgatgtgccagggcgcggacgacgtgttcgccgccgcggtc
ctcgcccgtgaggccggtctgatcgacctgcacgccggctgggcgaagatcggcatcgtg
ccgctgctggagacgaccgacgagctgaaggccgcggacgtcatcctcgagggcatgctc
gccgacccctcctaccgccggctcgtctcgctgcgcggcgatgtccaggaggtcatgctc
ggctactccgactcctccaagttcggcggcatcaccacctcccagtgggagatccaccgc
gcccagcgcaggctgcgtgacgtcgcccaccgccacggcgtgcggctgcgtctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcgcag
ccctggggcacgctcgagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtatctgatcccgtccctggccagggagaacctcgagctgacggtcgccgccacgctc
caggcctccgccctgcacacggcgccccgccagtccgacgaggcgctgtcgcgctgggac
gcggccatggacaccgtctccgacgccgcgcacgccgcctaccgcaggctggtcgaggac
ccggacctgccggcgtacttcttcgccgccacccccgtggaccagctcgccgaactgcac
ctcggctcgcgtccctcgcgccgtcccgactcgggcgccggcctcgacggactgcgggcc
atcccgtgggtgttcggctggacgcagtcgcggcagatcgtgccgggctggttcggtgtc
ggctccggcctcaaggcgctgcgcgaggccggtctggacaccgtgctcgcggagatgcac
ggcaactggcacttcttccgcaacttcatcgccaacgtggagatgacgctcgccaagacg
gacctgcggatcgcccgccactacgtcgacacgctggtgccggagaacctcaagcacgtc
ttcgaggtcatcgaggccgagcacgcgctcaccgtcagcgaggtgctgaaggtgacgggc
aacgacgaactgctcggctccaacccggtgctccagcagacgttcgccatcagggacgcc
tacctggacccgatctcctacctccaggtggcgctgctcaagcggcagcgtgacgcggcc
gagcgtggcgaggaggcggacccgttgctggcccgcgccctgctgctgacggtcaacggc
gtcgcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system