KEGG   Sporosarcina psychrophila: AZE41_02065Help
Entry
AZE41_02065       CDS       T04327                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
spsy  Sporosarcina psychrophila
Brite
Enzymes [BR:spsy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AZE41_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
429299..429826
Genome map
AA seq 175 aa AA seqDB search
MLSALLIAGGCGKNGVKLPVTGESVQSVMSPILNTKGDKIGEANFVEGIDGVTINIQAEG
LSPGKHGVHIHEMAVCTPPDFKSAGDHFNPGHKEHGFDNPKGFHLGDLPNLEVDADGKVT
AEVTTALVTLKPDVKNSLLDADGSSLVIHEKVDDYKTDPSGNSGDRIACAVIKKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctgcgctattgattgctggtgggtgtggaaagaatggagtgaaattaccagtc
actggagaaagcgtccagtcggtgatgtcaccgattttgaacacgaaaggggataaaatt
ggtgaagccaactttgttgaaggaatcgacggtgtgacaatcaatatccaggctgaagga
ttgtcgccaggcaaacatggcgttcatattcacgaaatggctgtgtgtacaccacctgat
tttaaatctgcaggagaccatttcaatccgggacataaagaacacgggtttgataatcca
aaagggtttcatttaggtgatctaccgaacctcgaagtcgatgcagatggtaaggtcact
gctgaagtgacgactgcattagttacgctaaagccagacgttaagaactcacttcttgat
gctgacggcagttcgcttgttattcatgaaaaagtagatgactacaaaacggatccatcg
ggtaactcaggtgatcgaattgcctgtgcggttattaaaaagaagtaa

DBGET integrated database retrieval system