KEGG   Strongylocentrotus purpuratus (purple sea urchin): 752989Help
Entry
752989            CDS       T01019                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03030  DNA replication
spu03410  Base excision repair
spu03420  Nucleotide excision repair
spu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    752989
   03410 Base excision repair
    752989
   03420 Nucleotide excision repair
    752989
   03430 Mismatch repair
    752989
Enzymes [BR:spu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     752989
    6.5.1.6  DNA ligase (ATP or NAD+)
     752989
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     752989
DNA replication proteins [BR:spu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    752989
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     752989
DNA repair and recombination proteins [BR:spu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     752989
   NER (nucleotide excision repair)
    Other NER factors
     752989
   MMR (mismatch exicision repair)
    Other MMR factors
     752989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 752989
NCBI-ProteinID: XP_001180844
LinkDB All DBs
Position
Un
AA seq 942 aa AA seqDB search
MPGQRSITSFFSSPKPKPPLPAEAIPENKTSNKKVRSPLHNRNGSPPSEEPAKKKARRIL
DSDSEEEENEDQKPTMMECEESKEEEKEENESKEAEVVVASQSVEKEQVSPTSAKKDVPL
RKTARKHMRKRESPPKQVKQECDSKDLEQNELEVKKEEKDKKIEQTTSQIKEEPASPTEK
AQNQERSSSKKSPKSRKDKSSPSDKKSKKSSGTDNKKEKEKTEEKKEEEKPMEKKEEEKL
MEKKEEEKLMEKKETKKENEKPVEKKETKKTNAFVWGSSDKKSDVKTSGTSFRPGSSSYH
PVEGACWKKDENVPYMALADTFSIIEETSGRLKTIEILSDFLTSVMLLTPGDLKMCIYLC
LNKLAPAYEGLELGIGDTVLMKAIAQATGRSVDKLKVDAAEKGDLGLVAESSRSTQRTMF
TPPRLTIKKVFSKLKDIANLSGNSCMSKKVDLIKGLLVACKNSEARYLIRSLGGKLRIGL
AEQSVLVALGHAGALAKPESDEMILKSKAHTSDSVKKAMDEAALLVKTAYCEMPTYDALI
PALLSHGVTELPNHCRLTPSIPLKPMLAHPTKGVSEVLNRFQDTPFTCEYKYDGERAQIH
LLESGKINIYSRNQENNTSKYPDIIARLSSSVDEKVTSCILDAEAVAWDVERKQILPFQV
LSTRKRKDADAGDIKVQVCVFAFDLLYLNGESLVRKPLRERRSLLRAHFKEVEGEFIFAK
SMISSDVDDIAVFLEESVKGNCEGLMVKTLDKDATYEIARRSHNWLKLKKDYLDGVGDTL
DVVVLGGFQGRGKRVGSYGGFLLACYDEENEEFQSICKIGTGFKEEELEKHTKFFKDHLI
EKPRPYYNYDSSVAPDHWFDAVQVWEIKAADLSVSPVHKAAIGIVDPAKGISLRFPRFIR
IRDDKKPEEATGSSQVASMYNNQDQIKNQQANKTSKSEEDFY
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaacgatcaataacctcttttttctcatcaccaaagcccaagccaccatta
cctgctgaagcaattcctgaaaacaaaactagcaacaaaaaggttagatctccacttcac
aataggaatggctcacctccaagtgaagaacctgctaaaaagaaagctagaaggattctg
gacagtgatagtgaagaagaagaaaatgaagaccagaaaccaaccatgatggagtgtgag
gagagcaaagaagaagaaaaagaagaaaatgagagcaaggaggcagaggtagtggttgct
tctcagagtgtcgagaaagaacaggtgtctccaacctctgctaagaaagatgtccctctc
cgaaagacggcccgcaagcacatgaggaaaagagagtctcccccaaaacaagtaaagcag
gagtgtgattctaaagacctggaacagaatgaactagaagtgaagaaagaggaaaaggac
aagaagattgaacagactacttcacaaataaaagaggaaccagcctcaccaacagagaaa
gcacagaatcaagaacgctcatcttccaaaaaatcaccaaaatcaaggaaagacaaatca
tctcccagtgacaagaaatccaagaagtcatctgggactgataacaagaaggagaaagaa
aaaacagaggagaagaaggaggaagagaaaccgatggagaagaaggaggaagagaaactg
atggagaagaaggaggaagagaaactgatggagaagaaggaaaccaagaaggagaatgag
aagccagtggagaagaaggaaaccaagaagactaatgcattcgtgtggggcagcagcgat
aagaaatctgatgttaagacctcggggactagctttagaccaggctcttcatcttatcat
ccagtggaaggcgcatgctggaaaaaagacgagaatgttccatacatggccttagccgac
accttttcaattattgaagaaacgagtggaagactgaagacaattgagatcttgtcagac
ttcttgacctctgtgatgctcttgacccccggtgaccttaagatgtgtatctacctgtgt
ctcaataagttagctccagcttatgaaggattagagctgggtattggtgatacggttctc
atgaaggctatcgcacaagctacaggtcgatcagttgacaagctgaaagttgatgctgct
gaaaaaggagatttagggctggttgcagagagcagtcgaagcacacagcgtaccatgttc
actcctccaaggcttacaatcaagaaagtcttctcaaaactcaaagatattgctaacttg
agtggaaattcatgtatgtcaaagaaggttgatctgatcaaagggctgcttgtagcttgc
aagaatagtgaagcaagatatcttatcagatcacttggagggaagttaaggataggttta
gcagagcagtctgttctcgtagctctagggcatgcaggtgctctagcaaaaccagagtca
gatgagatgattctgaagagcaaggcccatacatcagacagtgtgaagaaagctatggat
gaagcagcactgctggtcaagacagcttactgtgagatgcctacatacgacgccctgatt
ccggcattgttatcccatggtgtgacggaactacccaaccattgtcgtctgactccatcc
atccctctcaaacccatgttagctcatcctacaaagggcgtatcagaagtactcaacaga
tttcaagatacacctttcacctgtgaatacaagtatgatggtgaacgtgctcagattcat
ctcttagagtctggtaagattaacatatacagcagaaaccaggaaaacaacacctccaaa
taccctgacattatcgcaaggctttcctcttctgttgatgagaaggtaacatcttgtatc
ttagatgcagaagctgttgcttgggatgtggagaggaaacagatcttaccgttccaggta
ttgagtacgaggaagaggaaggacgctgatgccggtgatatcaaggttcaagtctgtgtc
tttgcatttgatcttctctatctcaatggagagtccttagtgaggaaacctctaagagag
cgcagaagtctgttgagggcccacttcaaggaagtggaaggagaattcatctttgctaaa
tccatgatctcgtctgatgtagatgacattgctgtattcttagaggaatcggttaaagga
aactgtgaaggactgatggtgaaaacgttggataaggatgccacttatgagatcgcaaga
cgctcacacaattggctcaagctgaagaaagactacttggatggtgttggagatacattg
gatgtggttgtgctcggtggattccaagggcgtggtaagagagtgggttcctatggagga
ttcctactcgcatgctatgatgaagagaatgaagagtttcaatccatttgtaagattgga
actggtttcaaagaggaggagctagagaagcacaccaagtttttcaaggatcatttgata
gagaagccacgcccttattataactatgacagcagtgtagctcctgatcattggtttgat
gctgtgcaggtctgggagatcaaggctgctgatctatctgtctcacctgttcataaagca
gccattggaatagttgatccagccaagggtatttccctacgatttcccagatttatccgt
atccgtgatgacaagaaaccagaggaggccacaggctcttcacaggttgccagcatgtat
aacaaccaggatcaaatcaagaaccaacaagcaaataaaaccagcaaatcagaggaggat
ttctactaa

DBGET integrated database retrieval system