KEGG   Strongylocentrotus purpuratus (purple sea urchin): 756308Help
Entry
756308            CDS       T01019                                 

Definition
(RefSeq) transmembrane protease serine 11G
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 557 aa AA seqDB search
MICAGYIAGGKDSCQGDSGGPMVVKTQTGFNSYEWTLVGVVSWGYGCADAGYYGVYSDVS
YLNQWVKDTMASNLKYKNHSFWARLHSTDSFLKDVHRYQLIMLMYLILACAFSAINAATE
CGQPEIPPVEMSTFIVGGQPAEPNSWPWMTEVIKNNGHYCGATLIDNEWVVSAAHCFESS
PNLNNYQFSTGGHQSADTGESTRQTFRAQKIIRHEGYSALSSSNDIALIKLDGQVTYDTY
SSPACLAESRPSDGTMAYVTGWGALRSGGISPNQLYQVNVPIVSQEACEAAYGSRSIDET
MICAGLKEGGKDSCQGDSGGPMVVKNQSGWTLVGVVSWGYGCAAEDYYGVYSDVSYLNPW
IQDTMASNCPDFSDYEFSVGGHEKADTGEATRQTFRAQKIIRHEGYKGNGNSNDIALIKL
DGLVQYNDYASPACLAESRPSNGVDAYVTGWGALRSGGISPNQLYQVNVPIVSQEACEAA
YGSRSIDETMICAGLKEGGKDSCQGDSGGPMVVKNQSGWTLVGVVSWGYGCAAEDYYGVY
SDVSYLNPWIKDTMASN
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatatgtgctggatatattgcgggaggaaaggactcatgccagggtgatagcggcgga
ccaatggtggtgaagactcaaactggatttaactcatatgaatggactcttgtaggagtc
gtcagctggggttacggctgtgccgatgcagggtactacggtgtatacagcgatgtgtcc
tatctcaaccagtgggtaaaggataccatggccagcaacttaaagtataagaatcacagc
ttttgggcacgtcttcattcaacggacagctttctgaaagacgttcacagatatcaactc
atcatgctgatgtacctgatcctcgcctgcgcttttagcgctattaacgcggctaccgaa
tgcggtcaaccggagattccaccggttgagatgtcaactttcatcgttggtggtcaacct
gccgaaccaaacagctggccctggatgactgaagtgatcaagaataacggacactactgt
ggagccacacttattgacaatgaatgggttgtctctgcagctcattgctttgaaagctca
cccaaccttaacaactaccagttttcaacaggagggcaccaaagcgcagataccggagag
agcactcgtcagactttcagagcccagaagattatccgtcatgaagggtattcagcactc
tccagcagtaacgacattgctctcatcaagcttgatggccaggtcacatatgatacctat
tcctcaccagcatgtctagctgaatccagaccaagtgatggtacaatggcctatgtcact
ggctggggagctctcaggtctggagggatttctcctaaccaactttatcaagtcaatgta
ccaatcgtcagtcaggaagcatgtgaagctgcgtacggcagtcgcagtattgacgaaaca
atgatatgtgctggattgaaagagggaggcaaggactcatgccagggtgatagcggcgga
cctatggtggtgaagaatcaatctggatggactcttgtaggagtcgtcagctggggttac
ggctgtgccgctgaagattactacggtgtctacagcgatgtgtcctacctcaacccatgg
atacaggataccatggccagcaactgtcccgactttagcgactacgagttttccgtagga
ggtcacgaaaaagcagataccggagaagcgactcgtcagactttcagagcccagaagatt
atccgtcatgaagggtataaaggaaacggcaacagtaatgacattgctctcatcaagctc
gatggtcttgtccaatacaatgactatgcctcaccagcctgtctagctgaatccagacca
agtaatggcgtagatgcctatgtcactggctggggagctttaaggtctggagggatttct
cctaaccaactttatcaagtcaatgtaccaatcgtcagtcaggaagcatgtgaagctgct
tacggcagtcgcagtattgacgaaacaatgatatgtgctggattgaaagagggaggcaag
gactcatgccagggtgatagcggcggacctatggtggtgaagaatcaatctggatggact
cttgtaggagtcgtcagctggggttacggctgtgccgctgaagattactacggtgtctac
agcgatgtgtcctacctcaacccatggataaaggataccatggccagcaactaa

DBGET integrated database retrieval system