KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1665Help
Entry
SPCG_1665         CDS       T00690                                 

Gene name
nanA
Definition
(GenBank) sialidase A precursor (neuraminidase A)
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00511  Other glycan degradation
spw00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPCG_1665 (nanA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPCG_1665 (nanA)
Enzymes [BR:spw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPCG_1665 (nanA)
Bacterial toxins [BR:spw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPCG_1665 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 BNR_3 YSIRK_signal BNR Gram_pos_anchor Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: ACB90917
UniProt: B2IRU8
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1637747..1640689)
Genome map
AA seq 980 aa AA seqDB search
MSYFRNRDIDIERISMNRSVQERKCRYSIRKLSVGAVSMIVGAVVFGTSPVLAQEGASEQ
PLANETQLSGESSTLTDTEKSQPSSETELSGNKQEQERKDKQEEKIPRDYYARDLENVET
VIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKD
EYFTMAVYNNTATLEGRGSDGQQFYGNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRVR
LYVNGVLSRTSLKSGNFIKDMPDVTHVQIGATKRANNTVWGSNLQIQNLTVYNRALTPEE
VQKRSQLFKRSDLEKKLPEGAVLTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLI
AGADERRLHSSDWGDIGMVIRRSEDNGKTWGDKVVISNLRDNPEAKDPAAPSPLNIDMVL
VQDPTTKRIFSIYDMFPEGRAVFGMPKTPEKAYEKIGDKTYQILYKQGESGHYTVRENGE
VYNAQNQKTDYRVVVNPTEPGYRDKGNLYKGQELIGNIYFAHSTKNPFRVANTSYLWMSY
SDDDGKTWSAPRDITPGLRKDWMKFLGTGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNG
SQSSRVIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTMNNERAQNTESTVVQLNNGDVKL
FMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPK
RENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLS
FRKFNWDFLSKDLISPTEAKVKRTREMGKGEMGKGVIGLEFDSEVLVNKAPTLQLANGKT
ATFLTQYDSKTLLFAVDKEDIGQEIIGIAKGSIESMHNLPVNLAGARVPGGVNGSKAAVH
EVPEFTGGVNGTEPAVHEIAEYKGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLA
SLGLTAFFLGLFTLGKKREQ
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttcagaaatcgggatatagatatagagaggatcagtatgaatcggagtgtt
caagaacgtaagtgtcgttatagcattaggaaactatcggtaggagcggtttctatgatt
gtaggagcagtggtatttggaacgtctcctgttttagctcaagaaggggcaagtgagcaa
cctctggcaaatgaaactcaactttcgggggagagctcaaccctaactgatacagaaaag
agccagccttcttcagagactgaactttctggcaataagcaagaacaagaaaggaaagat
aagcaagaagaaaaaattccaagagattactatgcacgagatttggaaaatgtcgaaaca
gtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcagagagttgatttatca
agtgaactagataaactaaagaaacttgaaaacgcaacagttcacatggagtttaagcca
gatgccaaggccccagcattctataatctcttttctgtgtcaagtgctactaaaaaagat
gagtacttcactatggcagtttacaataatactgctactctagaggggcgtggttcggat
gggcaacagttttacggtaattacaacgatgcacccttaaaagttaaaccaggtcagtgg
aattctgtgactttcacagttgaaaaaccgacagcagaactacctaaaggccgagtgcgc
ctctacgtaaacggggtattatctcgaacaagtctgaaatctggcaatttcattaaagat
atgccagatgtaacgcatgtgcaaatcggagcaaccaagcgtgccaacaatacggtttgg
gggtcaaatctacagattcagaatctcactgtgtataatcgtgctttaacaccagaagag
gtacaaaaacgtagtcaactttttaaacgctcagatttagaaaaaaaactacctgaagga
gcggttttaacagagaaaacggacatattcgaaagcgggcgtaacggtaaaccaaataaa
gatggaatcaagagttatcgtattccagcacttctcaagacagataaaggaactttgatc
gcaggtgcagatgaacgccgtctccattcgagtgactggggtgatatcggtatggtcatc
agacgtagtgaagataatggaaagacatggggagataaggtggttatctccaatcttcga
gataatcctgaagctaaagatcctgctgcgccatcgcctctaaatattgatatggttttg
gttcaagacccgacaacaaagagaatcttctcaatttatgatatgttcccagaaggtcga
gcagtttttggaatgccaaaaacacctgaaaaagcttatgaaaagataggggataaaact
tatcaaatcttgtataaacaaggagagtctggtcattatactgttcgtgagaatggagaa
gtgtataatgcacaaaatcaaaagacggattatcgtgttgtagtgaatccaacagaacct
ggctatagagataaaggaaatctttacaaaggtcaggaattgattggaaatatctatttt
gcacacagtacaaaaaatccatttagagtagccaatacgagctatctatggatgtcatat
agtgacgatgatggtaaaacttggtctgcaccgagagacattactccaggtcttcgcaag
gattggatgaagttcctaggaacaggtcctggaacaggaattgtacttcggaatgggcct
cacaagggacggattttgataccggtttatacgactaataatgtatctcacttaaatggc
tcgcaatcttctcgtgtcatctattcagatgatcatggaaaaacttggcatgctggagaa
gcggtcaacgataaccgtcaggtagacggtcaaaagatccactcttctacgatgaacaat
gaacgtgcgcaaaatacagaatcaacggtggtacaactaaacaatggagatgttaaactc
tttatgcgtggtttgactggagatcttcaggttgctacaagtaaagacggaggagtgact
tgggagaaggatatcaaacgttatccacaggttaaagatgtctatgttcaaatgtctgct
atccatacgatgcacgaaggaaaagaatacatcatcctcagtaatgcaggtggaccgaaa
cgtgaaaatgggatggtccacttggcacgtgtcgaagaaaatggtgagttgacttggctc
aaacacaatccaattcaaaaaggagagtttgcctataattcgctccaagaattaggaaat
ggggagtatggtatcttgtatgaacatactgaaaaaggacaaaatgcctataccctatca
tttagaaaatttaattgggactttttgagcaaagatctgatttctcctaccgaagcgaaa
gtgaagcgaactagagagatgggcaaaggagagatgggcaaaggagttattggcttggag
ttcgactcagaagtattggtcaacaaggctccaacccttcaattggcaaatggtaaaaca
gcgactttcctaacccagtatgatagcaagaccttgttgtttgcagtagataaggaagat
atcggacaggaaattattggtatagctaaaggaagcatcgaaagtatgcataatcttcct
gtaaatctagcaggtgccagagttcctggcggagtaaatggtagcaaagcagcggtgcat
gaagttccagaatttacagggggagttaatggtacagagccagctgttcatgaaatcgca
gagtataagggatctgattcgcttgtaactcttactacaaaagaagattatacttacaaa
gctcctcttgctcagcaggcacttcctgaaacaggaaacaaggagagtgacctcctagct
tcactaggactaacagctttcttccttggtctgtttacgctagggaaaaagagagaacaa
taa

DBGET integrated database retrieval system