KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1802Help
Entry
SPy_1802          CDS       T00050                                 

Gene name
alr
Definition
(RefSeq) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00473  D-Alanine metabolism
spy01100  Metabolic pathways
spy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPy_1802 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SPy_1802 (alr)
Enzymes [BR:spy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SPy_1802 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:spy01011]
 Precursor biosynthesis
  Racemase
   SPy_1802 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-GeneID: 902028
NCBI-ProteinID: NP_269811
UniProt: Q99Y98
LinkDB All DBs
Position
complement(1494936..1496036)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYGHGAVQVSKALLPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELELAVANAITVTIASLDWIALARLEKKE
CQGLKVHVKVDSGMGRIGLRSSKEVNLLIDSLKELGADVEGIFTHFATADEADDTKFNQQ
LQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIVSYGLNPSGSDLSLPFPLQ
EALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIGYADGWTRNMQGFSVLVDGQ
FCEIIGRVSMDQLTIRLPKAYPLGTKVTLIGSNQQKNISTTDIANYRNTINYEVLCLLSD
RIPRIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttccatcgcccaacagttgcaagggtcaacttacaagctattaaggag
aatgttgccagtgttcaaaagcatattccactaggggtaaaaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcactcctacctcaagtggat
gggtactgtgtgtcaaatcttgatgaggctttgcaattacgtcaagcaggtattgataaa
gagattttaattcttggggttttgctgccaaatgaattagagttagcagttgctaatgct
attactgttacaatcgctagtttagactggatagctttagctagactggagaaaaaagaa
tgtcaaggcttaaaagttcatgtaaaagttgattctggtatggggcggatcgggcttcgt
tcttcaaaagaagtcaatttattgattgatagtctaaaagagttgggtgctgatgtagaa
ggtattttcactcattttgccacagctgatgaggcagatgatactaaatttaaccagcag
ttacagttttttaaaaagctgatagctggacttgaggataagcctcgtttagtacatgct
agtaattcagccacaagtatctggcatagtgataccatttttaatgctgttcgtttagga
attgtcagttatggtttgaatccaagtggttctgatctaagcttaccgtttccactgcaa
gaggctttatctctagaatctagcttagtgcatgtcaagatgatttcagctggtgataca
gtcggttatggagctacttatactgccaaaaagtctgaatatgtagggactgtcccaatc
ggttatgcagatggctggaccaggaacatgcaaggcttttcggtgttagttgatggacaa
ttctgcgaaattatagggcgtgtatcgatggatcaactgaccatacgacttcccaaagca
tatcctttaggaacaaaagtcactttgattggcagcaatcagcaaaaaaatatttctaca
acagatatcgcaaattaccgtaatacaatcaattatgaagttctatgccttttaagtgac
cgtattcctcggatatattaa

DBGET integrated database retrieval system