KEGG   Serratia sp. AS13: SerAS13_1138Help
Entry
SerAS13_1138      CDS       T02012                                 

Definition
(GenBank) 6-deoxyerythronolide-B synthase., Glutamate-1-semialdehyde 2,1-aminomutase
Organism
sra  Serratia sp. AS13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1243312..1251150
Genome map
AA seq 2612 aa AA seqDB search
MPSHQLFNRGFNSFNQLLPELAVQHTDKTAFEFLRSAKEIKNQSYRQLHQRAASLASALQ
QYGHRGDRVILLYPDGEDFIGAFFGCLYAGMIAVPVPMPAKASGSAWERFIGVLRNAQTE
FIVTTGKGAETLISLSLPLAPLIFTFDQLPAVALPAGYRLQHLDSHFSGAFNPAPVSDDD
VAFLQYTSGSTGTPKGVMVTHGNLWANSQAIHRYFGHHNESRGMIWLPHFHDMGLIGGLL
QPVFGAFPCRVMSPMMLMKNPLNWLKQVSEFRATTSGGPNFAYDLCVRKISPQQAEGLDL
SNWDVAFCGAEPIRPATLRQFSEHFAPAGFRGQAFLPCYGMAETTLIVTGREKGQGMAVA
EEKSGDVVNCGEALPGTDVRIVDPDTLQPLAAGQTGEIWLRGPSIAAGYWDNPAATEATF
QACIEPDQAHWLRSGDLGFLQAGALYVTGRVKELLIVNGQNHYPTDIEETIIGADILLAD
ATVCVFAAEIAQTEQAVALLEIPERLKETLDTAALNRRLNAAVAERHGITLGEWVWVGRR
AIPRTTSGKLQRTRAREMYRQNELAVQWRSRAEQPQAAQVADVASYSVPALAALIAGIIG
TAVNGAVGEEQWDEAFTAFGLNSLQAVGVIGELEHHLGRELSPALIYDYPTINKLAAGLL
QPVARPEAASTAVASQDIAVIGIGVELPGHSGVQALWAMLQQGQSTTGEIPAHRWAGSSL
SGFNRKGSFFDRVSDFDAGYFGISPREAEYIDPQHRLLLETVQQALTDAGLQASALRGSD
TAVFIGISASDYALVSGDRVSAYSGLGNAHSIAANRISYLYDFKGPSVAIDTACSSSLVA
IDGAMQSLRSGRSSLAIAGGVNLALTPHLQKVFTEAQMLAPDGQCKTFDARADGYVRGEG
CGIVVLKPLAQALADGDRVYATLVASAINQDGRSNGITAPNGPSQQAVIARALAEAGIDS
NHIDYVEAHGTGTALGDLIEYQALEAVFAERSQSAPVQVGSVKTNIGHLEAAAGVLGVVK
TALMLHSQQRVPHLNFQQKNPHIAAISRRVAVAGNHSCAWESAAGQRYAGVSSFGFGGTN
SHVILRDCPQAAKRDETAQPLALLLVASHEEQGFNAQRDGIYNTLQMQHDVDVPAWCRLV
NTRYDHPRYRGFAYGDNRRQLAENLAQLTANKVEKPRPQVWLFPGQGTQQIGMGAALYQH
LPHYRTCFDSLAERVQERYQIDIRQALHAQDDRWQHCAKTCQLALFACSYATADSLLQFG
LRPAAVIGHSLGEYCAAVVAGQISLDQGLAMVHQRALLMDSLEQQGAMAVVFSGENEVRR
SIAPWADDIDIAAFNTPTLTTITGSSPAIDACLQAVSAQGGHARRIKTTNAFHSHLMDPI
LPAYRLWLTQHIDFAEGNIPFYSNLDALPRRHTDADYWSQQIRQPVHFLQGIQALREEGK
YTFVDLSADSSLGKFVAATDRSQPILAAADHRHEYQSLLTLLGSLWQQGHDIDWSRLYRA
TSREALTLPAIQFCRKTYWLADETPTLPPSSHEDAMSKQHQLHAEIKAIIAGYLGASPEA
LDDDLPFLEMGADSLVLLDAINTIKDRYGVVIPLRSLFEELNTLDAVIHYVVERAQVAEP
VALASESRVVTAMPQADASVIPASSPQFEQEWGIPATAPAELQGVIARQLEVMSQQLRLL
SGGHAQPLSAPALPSVPASAPVAALPAPAVASNAPATAAPAKAGAHTSWFKKETKKASLG
AERDKHIQRLTQQFVSKTPSSKHNAQQYRAVLADNRASAGFRLSTKEMLYPLVGVRSQGS
RIWDADGNEYIDFTMGFGANLLGHAPECVQQAVAAQLAQGMQIGPQSALAGEVATLIAEL
TGQHRVAFCNSGSEAVMSAVRLARAVTGKNKVALFSGSYHGVFDGILGRQQGGETPERAV
PIAAGTTASLVEDLLVLDYGSEESLALIARYADQLAAVIVEPIQSRYPDHQPRDYLHALR
KLTAERNIALMFDEVITGFRLAAGGAQAYYGVQADIATYGKIVGGGMPIGAIAGSARFMD
SIDGGFWQYGDESWPQSELIFFAGTFSKHPLTMAASKAVLDYIKSHPGLYDDINQKTHYL
AQTLNTWFVTTGTPIEIVSAGSLFRFKFSGNYDILFHHLMLRGIFIWEGRNCFVSTAHSS
QDIELFIAAVKESVNAMRVDGFFGEAGLSPDTPYPAADSQQRFMLLAAKDESGLCAGNIG
CVVETAREIDGATLAEAWALLSERHESLRMQFNGAGELQVASGVVNVDFIEERSESTDPA
ARLAEFAAKPFVLTAAPLARLLLLSQPGQTALALTAHHTVADGWSFMVMLRELLHIYDAL
AAGFSPELSAAPSYLHFMRAEKTANDAEVAQRLAAIPARRFDPASALPVVLQAAPYQGQR
LKQGLAYPNLSAQLRKVAAELRTTRFVMLNALFALTLEKFIGHSLLPVAVPNAGRDFENS
EGVVGQCVSLMPLCFNSAASASLPEFVAKVHQAILAQRDAPVLPSRCFHGEQAPLPLLAT
FNVEPSVPLAEMRQWQASLSMLPVNAVEFPLMINVVEMADELSIELDYQARYFTEQTASA
LLEQYLAAIAVLAEQGVSVVNQQFYSQVAVEV
NT seq 7839 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatcagttgtttaacaggggatttaattccttcaaccaactattgcccgaa
cttgctgttcaacataccgacaagacggcatttgagtttttgcgaagtgccaaagaaata
aagaatcaaagttacagacaattgcatcagcgcgccgcctctctggctagcgcacttcag
caatacggtcatcggggcgacagggttattttactttatcccgacggcgaagattttatt
ggcgcttttttcgggtgtctttatgccggcatgattgccgtgcctgttcctatgccggcc
aaggcctcaggcagcgcgtgggagcgctttattggggttttacgcaatgcgcaaacggaa
tttattgtcaccacagggaaaggcgctgaaaccttaatatcgctcagtttaccgctggcg
ccgctaatttttacctttgatcaactgcccgccgtggcattgccggcggggtatcgcctt
cagcatctcgatagccatttttcaggggcgtttaatcctgcgccggtgagcgacgacgat
gtggcttttttgcaatatacctcgggttcaaccggtacgccaaagggggtcatggtcact
catggcaacctgtgggccaactctcaagccatccatcgctatttcggtcaccacaatgaa
agccgcggcatgatatggctgccgcatttccatgatatggggctgatcggcggcctgctc
cagccggtattcggggcattcccttgccgggtgatgtcgccgatgatgctgatgaaaaac
ccgcttaactggctaaagcaggtgtcagagttccgtgcgacgacgtcgggtggccctaat
ttcgcctatgacctctgcgtgcgcaaaatcagcccgcagcaggccgaaggcctggatctt
tccaactgggatgtggcgttttgcggtgcggagcctatccgcccagctacgctgcgccag
ttcagtgaacactttgccccggccggcttccgggggcaggcgtttttaccctgctatggc
atggcggaaaccacgctgattgttaccggcagggagaaaggccaggggatggcggtcgcc
gaagaaaaatcgggggatgtcgtcaactgtggcgaggcgttgcccggcaccgatgtccgc
attgtcgatcctgatactctacaaccgcttgcggccgggcaaaccggcgagatttggtta
cgtgggcccagcattgcggccggctattgggataacccggcggcgacagaggccaccttc
caggcgtgcatcgagcctgatcaggcgcattggttacgcagcggcgatttgggtttcctg
caagcgggggcgctgtacgtcaccggacgtgtgaaagaacttctgatcgtcaatgggcaa
aaccattacccgacggatatcgaggaaacgatcataggagcagatattttgctggcagac
gcaaccgtttgcgtcttcgccgccgagattgcccaaactgaacaggcggtggccttgctg
gagatcccggaacgtctcaaagagaccctggatactgcagcgttgaaccggcgtttgaat
gccgcggtggccgagcggcacggcataaccctgggggaatgggtatgggtcggccgccgg
gccattccacgcaccaccagtggcaaattgcaacgtacccgcgccagagaaatgtaccgg
caaaatgagctggcggtgcaatggcgtagccgggccgagcaaccgcaagcggcccaggtt
gccgatgttgcctcatacagcgtgcctgccctggccgcgcttatcgccggtatcatcggc
actgcggtcaacggcgcggtcggtgaagaacagtgggatgaggcttttaccgcctttggc
ctgaactcgttacaggccgttggcgtgatcggcgagttagagcaccatttggggcgtgag
ttgtcgccagcgctgatttacgattatccgacgatcaataagctggctgcgggtctgttg
caacccgttgcgcgaccagaagccgccagcacggccgtggccagccaggatatcgccgtg
attggtatcggggttgaactgccaggccacagtggcgtgcaggcgctgtgggcgatgttg
cagcaggggcaaagcaccacgggggaaatacccgctcaccgttgggcgggctcttcactc
agcggttttaaccgcaagggcagtttctttgaccgcgtgagtgattttgacgccggttac
tttggtatttcgccgcgcgaggcggagtatatcgatccgcaacatcgcctgctgttggaa
accgtgcaacaggcgctgaccgatgcggggttacaggcttcggcgctgcggggcagcgac
accgcggtgtttatcggcatcagcgccagtgattatgccctggtctcgggcgaccgggtt
tccgcgtatagcgggttgggcaatgcacacagcattgccgccaaccggatatcttatctt
tatgattttaaagggccaagcgtcgccattgatacggcctgctcatcttcgctggtggcc
atcgacggggccatgcaaagcctgcgctcaggacgcagttcgctggctattgccggcggc
gtgaatctggcgttgacgccgcatttgcaaaaggtcttcaccgaggcgcagatgttggcg
ccggacggccagtgcaaaacctttgacgcgcgcgccgatggctatgtgcgtggcgagggg
tgcggcatcgttgttttgaaacccctggcgcaggcattggccgatggcgatcgggtttat
gccaccttggttgccagcgctatcaatcaggatggccgcagcaacggcatcacggcacct
aacgggccatcgcagcaggcggtgatcgcgcgggcgctggccgaggcgggcatcgacagc
aatcacatcgactatgtggaagcgcatggcaccgggacggcgctgggtgacctgatcgag
taccaggcgctggaagcggtgtttgccgagcggagccaatcggcaccggttcaggtggga
tccgtcaagaccaatattggccatctcgaagccgcagccggcgtgcttggggtggtgaag
accgcgttgatgttgcatagccaacagcgcgtgcctcatttgaatttccaacagaaaaat
ccgcatatcgccgccattagccgccgggtggcggtagcaggcaaccactcttgcgcctgg
gagtctgcggcgggccaacgttatgccggtgtcagcagttttggcttcggcgggacgaac
agccacgtgatactgcgtgattgtccgcaggccgcgaagcgcgatgagacggcccagccg
ctggcgctgttgctggtggcctcgcacgaagaacagggtttcaacgcgcagcgtgacggc
atttataacaccttgcaaatgcaacacgacgttgacgtcccggcatggtgtcgcctggta
aatacccgttatgaccacccgcgctatcgtgggtttgcctatggcgacaaccgccggcaa
ttggcagaaaacctggcgcaactcaccgcgaataaagtggagaaaccgcgcccgcaggtc
tggctcttcccggggcagggaacgcagcaaatcggtatgggggcggccctataccaacac
ctgccgcactaccgcacgtgcttcgatagcctggcagagcgggttcaggaacggtatcaa
attgatattcggcaagcgctgcatgcgcaggacgaccgttggcagcattgcgccaaaacc
tgccagttggccctgtttgcctgcagctatgccacggcggacagcttgttgcagttcggg
ctacgcccggcggcggtgattggccatagcctgggcgagtattgcgctgcggttgtcgcc
ggccagatttcgctggatcaggggttggcgatggttcatcagcgcgcactcctgatggac
agcctggagcagcagggcgcgatggcggtggtgttcagcggcgaaaacgaggttcgccgc
agtatcgctccctgggccgatgatatcgatattgccgcgttcaatacgccgacgctgacc
accatcaccggcagttcgccggcgattgatgcttgtctgcaggcggtttcagcgcaaggc
ggccatgcccgccggattaaaaccaccaacgcctttcattctcacctgatggatcccatc
ttgccggcgtatcgcctttggttgacgcagcatattgattttgctgaggggaatatccct
ttctacagcaatctggacgctctgccacgccggcacaccgatgccgactactggagccaa
caaatccggcaacccgttcatttcctgcaaggcatacaggcgctgcgggaggaagggaaa
tatacctttgtggatctgagcgccgacagttcgctgggcaagtttgtcgccgccaccgat
cgcagccaaccgattttggcggccgcggatcatcgccatgaataccaatcactgctgacg
ctgctgggttcgttgtggcagcaagggcatgacatcgactggtccaggttgtatcgcgca
acaagtcgtgaagcgttgacgctgccggccattcaattctgtcggaaaacttattggctg
gccgatgaaacgccaacgctgccaccatcttcacatgaggacgctatgtcaaaacaacat
caattacacgccgaaatcaaagcgatcattgccgggtatttgggggcatcgcccgaagct
ctggatgatgatctgcccttcctggaaatgggggccgactcgctggtcttgctggatgcg
atcaataccatcaaagatcgctatggcgtggtgatcccgctgagatcgctgtttgaagag
ttgaatacgctggatgcggtgatccattacgtcgtggagcgtgcgcaagtggcggaaccc
gtcgcgctggccagtgaaagccgggttgtgacggcaatgccgcaagccgacgcttcagtg
atacctgcgtcgtccccccagttcgaacaggaatggggaataccggcaacggccccggcc
gagttgcaaggcgtgattgcgcggcaattagaggtcatgtcgcaacagttgcgcctgtta
agcggcggccatgctcaaccgctttccgcacccgcgctgccttcggtaccggcaagcgca
ccggtagccgcacttcctgcaccggcagtggcgagcaacgcgccggctaccgctgcaccg
gccaaagccggcgcacacactagctggtttaaaaaggaaaccaagaaagcctcattaggg
gccgagcgcgataaacacatacagcgattgacgcagcagtttgtcagcaaaaccccgagc
tccaagcacaatgcgcagcagtaccgcgccgtgctggcggataaccgggcatcggcgggt
ttccgtttatccacgaaggaaatgctgtatcccctggtgggcgtgcgttcacaaggctcc
cgtatttgggatgccgacggtaacgagtacattgatttcaccatggggtttggcgccaac
ctgttgggccatgcaccggagtgcgtgcaacaggccgttgccgcacagctggcgcaaggc
atgcaaatcgggccgcagagcgcgctggccggtgaggttgcaacattgattgcagagctg
acgggccagcaccgcgtggcgttctgcaactccggttctgaagccgtcatgagcgcggta
cgcctggcgcgtgccgtaacgggcaagaacaaagtggcgctgttcagcggctcttatcac
ggcgttttcgatggcatcctggggcgtcagcaggggggtgaaaccccggagcgggcagtg
ccgattgccgcagggacaacggcgtccctggtcgaggatctgctggtgctcgactacggc
agcgaagagagcctggctttgattgcccggtatgccgatcaactggccgcggtcattgtg
gagccgattcaaagccgctatcccgaccatcagccgcgcgactatttgcatgcgctgcgt
aagctgacggccgagcgcaatatcgccttgatgttcgatgaagtgattaccggcttccgc
ctggcggccggcggcgcgcaggcgtattacggtgtccaggccgatattgccacctacggc
aagattgtcggcggcggcatgccgatcggcgccattgcggggtcggcgcgttttatggac
agtattgatggcggtttctggcaatacggcgatgaatcctggccgcagtccgaactgatt
ttctttgccgggaccttctccaaacaccctctgaccatggcggccagtaaagcggtgctc
gactatatcaagagccaccccggtctctatgacgacatcaaccaaaagacgcattacctc
gcgcagacgctcaacacctggtttgtcacgacggggacgccgatcgagatcgtctcggcg
ggcagtttgttccgtttcaaattcagcggtaactacgacattttgttccatcacctcatg
ctgcgcggcatatttatttgggagggccgcaactgcttcgtgtccaccgcgcactcttcg
caagatatagagctctttatcgcggcggtaaaagagagcgttaatgccatgcgcgtcgat
ggtttcttcggtgaagccggtttgtctcccgatacgccttacccggcagctgacagccag
caacgttttatgctgctggccgccaaagacgaaagcgggctgtgtgcgggcaacattggc
tgcgtggttgagacggcgcgtgagattgacggagcaaccctggctgaggcgtgggcgctg
ctgagcgaacgtcatgaatccttgcgtatgcagttcaatggggcgggggagttgcaggtg
gcgtcgggcgtggtcaacgttgattttattgaggagcgcagtgagtccacggaccctgct
gcccgcttggccgagtttgccgctaaacccttcgtcttgacggcggcgccgttggcgcgc
ctcttgttgctgagccagcctggccaaacggccctggcgttgacggcgcaccatacggtg
gcggatggctggtcatttatggtgatgctgcgtgaactgctgcatatctatgatgcgctg
gcggcagggtttagccctgagctgtcggcggcgccgagctatttgcattttatgcgtgcg
gaaaagacggccaatgatgcagaggttgctcaacggctggccgctatccccgcgcgtcgt
ttcgatcccgccagcgcgctgccggttgtcctgcaggccgcgccgtatcaaggccagcgt
ttgaagcaagggctggcttacccgaacttgtcggcccaactgcgtaaagtggccgccgaa
ctgcgcacgacccgctttgtgatgttgaacgccctgtttgcactgacgctcgagaagttt
atcggccactctctgttgcctgtcgctgtgccgaatgccgggcgtgacttcgagaacagc
gaaggggtggtcggccaatgcgtcagcctgatgccgttgtgtttcaacagcgccgcgagc
gcttcgttgccggagtttgtggccaaggtgcatcaggccattttggcgcagcgtgatgcg
ccggtattgccgtcacggtgtttccatggcgagcaagcgccactgcctctgcttgccacg
ttcaatgttgagccgtccgttccgttggcggaaatgcgccagtggcaggccagcctgtcg
atgctgccggtcaacgcggtcgagttccccttgatgatcaacgtggtggaaatggccgat
gagctgtcgattgagttggattatcaggcgcgttatttcaccgagcaaaccgcttcagcg
ctgctggagcagtatctggctgcgatcgcggttctggctgagcaaggtgtgagcgtcgta
aatcagcagttttattcacaggttgccgtggaagtatga

DBGET integrated database retrieval system