KEGG   Streptomyces rapamycinicus: M271_07560Help
Entry
M271_07560        CDS       T02907                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
src  Streptomyces rapamycinicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1988189..1989262)
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVEPMLAKAVATIPPGMVYEGKWDGFRAVVFRDGDEIEIGSRTTKPLTRYFPE
LAEALLANLPPRCVLDGEIVIVREGRLDFDALLERIHPADSRVRMLAEHTPASFVAFDLL
ALGDASLLDTPQRERRAALTEALRHAEDPVHLAPCTDDLEVARQWFESYEGAGLDGVVAK
SPELRYRPGERVMVKVKHERTADCVVAGYRVHKSGQGIGSLLLGLYDDTGRLQHVGVSAA
FTARRRQELMAELEPLRMATVEGHPWADWAREEAHAQGRMPGAPSRWTGVKDLSWVPLRP
ERVCEVAYDHMQSRRFRHTARFRRWRPDREPVQCTYDQLEEPVSYDLRQVLGLAPDP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgcctcccgtcgagccgatgctggccaaggccgtggccaccatc
ccgcccgggatggtctacgagggcaaatgggacggcttccgggccgtcgtcttccgcgac
ggggacgagatcgagatcggcagccgcaccaccaagccgctcacccgctacttccccgaa
ctggccgaggcgctgctcgccaacctcccgccgcgctgcgtcctggacggcgagatcgtc
atcgtgcgggaggggcggctggacttcgacgccctgctggagcggatccaccccgccgac
tcccgggtgcggatgctggcggagcacaccccggccagctttgtcgccttcgacctcctc
gccctcggcgacgcctcgctgctggacaccccgcagcgcgagcgccgcgcggccctcacc
gaggcgctgcgccacgccgaggacccggtgcacctggccccctgcaccgacgatctcgag
gtggccaggcagtggttcgagagctacgagggggcggggctcgacggcgtcgtggccaag
agccccgagctccgctaccgccccggtgaacgcgtgatggtcaaggtcaagcacgagcgc
acggcggactgtgtggtggccggctaccgcgtccacaagtccggccagggcatcggctcc
ctgctgctcggcctgtacgacgacaccggccgcctccagcacgtgggcgtcagcgccgcc
ttcaccgcacgccgccgccaggagctgatggccgagctggagccgctgcgcatggcgacc
gtcgagggccacccatgggccgactgggcgcgcgaggaggcccatgcccagggccggatg
ccgggcgcgcccagccgctggaccggggtcaaggacctgtcgtgggtgccgctgcgcccg
gagcgggtgtgcgaggtggcctacgaccacatgcagagccgccgcttccggcacaccgcc
cgattccggcgctggcggccggaccgggagccggtgcagtgcacctacgaccagctggag
gagccggtctcctacgatctgcggcaggtgctggggctcgccccggatccgtag

DBGET integrated database retrieval system