KEGG   Streptomyces rapamycinicus: M271_20645Help
Entry
M271_20645        CDS       T02907                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
src  Streptomyces rapamycinicus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:src00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    M271_20645
Enzymes [BR:src01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     M271_20645
DNA repair and recombination proteins [BR:src03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     M271_20645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5164255..5165268)
Genome map
AA seq 337 aa AA seqDB search
MSPIAEVEGRRITLRNLDKVIHPATGTTKGELLHYLASTADALLGHLRGRPLAFLRYPDG
PDGQKFFTKNPPPGTPSWVMTAEVTRHKGETARQVVIQDLPSLMWSANLVVELHTPMWRI
DQGVGIADRLVFDLDPGPPATIVDCRVVAVWLRERLADDGLTAYAKTSGSKGLHLLVPVE
PTPSRQTTAYARRLALEAANAMPDLVIRKMTRSLRPGKVYVDFSQNAAAKTTAAPYTPRA
VPEPAVSAPVTWEEVEACGDPAALTFLIDDIPARLDRHGDLLAPLLDPAEGRPLPTGEAA
AEEDAGAAVEEDAGAAVEEDAEDEDSGQGDGEGAADR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgatcgcggaggtggaggggcggcggatcacgctcaggaacctcgacaaggtc
atccatccggccaccggcaccaccaagggcgagctgctgcactacctggcgtccaccgcg
gacgcgctcctcggccatctgcgcgggcggccgctggcgttcctgcgctacccggacggc
cccgacggccagaagttcttcaccaagaacccgcctccgggcacgccttcctgggtgatg
acggccgaggtcacccgccataagggggagaccgcgcggcaggtggtgatccaggacctg
ccctcgctgatgtggtcggccaacctcgtggtggagctccacaccccgatgtggcggatc
gaccagggcgtgggcatcgccgaccggctcgtcttcgacctcgaccccgggccgcccgcc
acgatcgtggactgccgcgtcgtcgccgtatggctgcgcgaacggctggccgacgacggc
cttacggcgtacgcgaagaccagtggctccaaggggctgcatctgctggtgccggtggag
ccgaccccctcccggcagaccaccgcctacgccagacggctggccctggaggccgcgaac
gccatgccggacctggtcatccgcaagatgacccgctcactgcggcccgggaaggtgtac
gtggacttcagccagaacgccgccgcgaagaccaccgccgccccgtacaccccccgcgcc
gtccccgaaccggccgtctccgcgcccgtcacctgggaggaggtcgaggcgtgcggcgac
cccgcggcgctgaccttcctgatcgacgacatccccgcgcgcctcgaccgccacggggat
ctgctggccccgttgctggacccggcggaggggcgcccgctgccgacgggcgaggccgcc
gccgaggaggacgccggggccgccgtcgaggaggacgccggggccgccgtcgaggaggac
gccgaggacgaggacagtggccagggcgacggcgaaggcgcggccgaccgatga

DBGET integrated database retrieval system