KEGG   Streptomyces rapamycinicus: M271_21200Help
Entry
M271_21200        CDS       T02907                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
src  Streptomyces rapamycinicus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    M271_21200
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    M271_21200
Enzymes [BR:src01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     M271_21200
Peptidoglycan biosynthesis and degradation proteins [BR:src01011]
 Precursor biosynthesis
  Racemase
   M271_21200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5310021..5311175)
Genome map
AA seq 384 aa AA seqDB search
MDETPMRARAVVDLAALRANVRALRAAAPTAELMTVVKSDAYGHGMVPCARAARAAGADW
LGAATPEEAFALRAAGDTGRLMCWLWTPGGPWRRAIEADIDVSASGLWALREAVAAARAC
GRTARLHLKADTGLGRNGCQPADWPALVAEARAAEAEGAIRVTGLWSHFACADEPGHPSI
AAQLSVFREVIAHAEQAGLRPEVRHIANSPATLTVPDSHFDLVRTGISTYGICPSPELGT
SADFGLRPVMTLSAALASVKRVPGGHGVSYGHRYVTPGETTLALVPVGYGDGIPRHASGT
GPVLVAGKWRTIAGTVAMDQFVVDLGGDTAAPGDEAVLFGPGDRGEPTVEDWARAVGSIG
YEIVTRISARIPRVYVDEDGGTGN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagacaccgatgcgcgcccgtgccgtggtcgatctggccgccctacgggccaac
gtgagggcgctgcgcgccgcggcacccacggccgagctgatgaccgtggtcaagtcggac
gcctatggccacggcatggtcccgtgcgcgcgcgccgcccgcgcggcgggcgcggactgg
ctgggcgcggccacgcccgaggaggcgttcgcgctgcgggcggcgggggacacgggccgg
ctgatgtgctggctgtggacgcccggcggcccctggcggcgggccatcgaggcggacatc
gacgtctcggccagcgggctgtgggcgctgcgcgaggccgtcgccgcggcccgcgcgtgc
gggcgtaccgcgcggctgcacctgaaggcggacaccgggctcggccgcaatggctgccag
cccgccgactggcccgccctggtcgccgaggcgcgcgccgccgaggcggaaggggccatc
cgggtgacggggctgtggtcccacttcgcgtgcgcggacgagccgggccatccgtccatc
gcggcgcagctgtcggtcttccgcgaggtgatcgcccacgccgaacaggcggggctgcgg
ccggaggtgcgtcacatcgccaactcaccggcgaccctgaccgtgcccgattcccacttc
gacctcgtccggaccggcatctccacctacggcatctgcccgagccccgaactcggcacg
tccgccgacttcgggctgcgcccggtgatgacgctgtccgccgcgctcgcctccgtgaag
cgggtgccgggcggtcacggcgtctcctacgggcaccgctatgtgacccccggcgagacg
accctcgcgctggtgcccgtcggctacggggacggcatcccgcgccatgcctcgggcacc
ggcccggtactggtcgcgggaaagtggcggaccatcgcgggcacggtcgccatggaccag
ttcgtcgtggatctgggcggcgacaccgccgccccgggggacgaggcggtgctgttcggt
ccgggggaccggggcgagccgaccgtcgaggactgggcgcgggccgtgggctcgatcggc
tacgagatcgtgaccaggatctcggcccgtattccccgcgtttatgtagatgaggacggg
ggcacagggaactga

DBGET integrated database retrieval system