KEGG   Streptomyces rapamycinicus: M271_23820Help
Entry
M271_23820        CDS       T02907                                 

Definition
(GenBank) hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
src  Streptomyces rapamycinicus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
  Amino acid metabolism
   00380 Tryptophan metabolism
    M271_23820
Enzymes [BR:src01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     M271_23820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5927574..5928797)
Genome map
AA seq 407 aa AA seqDB search
MNGLPATAVADEAVRLDAADPLRAKRDAFTLDDTIYLDGNSLGALPRAVPPRLADVVARE
WGELRIRSWEESGWWTAPERIGDRVARLVGAAPGQVVVGDSTSVNVFKAVVAAVRIAQER
GAHRDQILVDEATFPTDGYIAESAARMTGCTVWPVAAGDVPTAVGARTAVALVNHVDYRT
GRLHDLPGTTAAVHAAGALVVWDLCHSAGALPVGLDAHGVDLAVGCTYKYLNGGPGAPAY
LYVAQAHQPRFDSPLPGWNSHADPFGMASVYTPADGAVRGRVGTPDILSMLALEAAIEVW
DDVSIEDVRAKSLALTDFFLRCVETYVPAGRVRSITPAAHAERGSQVALRCAAAGEAGEV
MAELVRRGVVGDFRRPDVLRFGFTPLYTGFAEVARAARVLADVLKEG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcctccccgcgaccgctgtggccgacgaggccgtcaggctcgacgcggccgac
ccgctgcgcgccaagcgcgacgccttcaccctcgacgacacgatctacctcgacggcaac
tcgctgggcgcgctgccccgcgccgtcccgccccggctggccgatgtggtcgcccgcgaa
tggggtgagctgcgcatccgctcctgggaggagagcggctggtggaccgcgccggagcgg
atcggcgaccgcgtcgcccggctcgtcggcgccgcccccggccaggtggtggtgggcgac
tcgacgagcgtgaacgtcttcaaggcggtcgtcgcggccgtacggatcgcccaggagcgc
ggcgcccaccgggatcagatcctggtggacgaggccaccttccccaccgacggctatatc
gccgagtccgccgcccggatgaccggctgcaccgtgtggccggtggccgcgggcgacgtc
ccgaccgccgtcggcgcgcgcaccgccgtcgcgctcgtgaaccacgtggactaccggacc
ggccgcctccacgacctgcccgggaccacggccgccgtgcacgcggcgggcgcgctcgtg
gtgtgggacctgtgccacagcgcgggcgccctgccggtcgggctggacgcccatggggtg
gacctcgcggtgggctgcacgtacaagtacctcaacggcgggcccggcgcgcccgcgtat
ctgtatgtcgcccaggcccatcagccccgcttcgactcgccgctgcccggctggaactcg
catgccgaccccttcggcatggcctccgtctacaccccggccgacggcgcggtccgcggc
cgcgtcggcaccccggacatcctctcgatgctggcgctggaggccgcgatcgaggtgtgg
gacgacgtgtcgatcgaggacgtcagggccaagagcctggccctgacggacttcttcctc
cgctgcgtcgagacttacgtcccggcgggccgcgtccggtcgatcacccccgccgcgcac
gccgagcgcggcagccaggtggcgctgcggtgcgcggcggcgggggaggccggggaggtg
atggcggagctggtgcggcgcggtgtcgtgggcgacttccgccgccccgatgtgctgcgc
ttcggcttcaccccgctctatacgggcttcgccgaggtggcgcgggcggcgcgggtgctg
gccgatgtgctgaaggagggctga

DBGET integrated database retrieval system