KEGG   Streptomyces rapamycinicus: M271_39495Help
Entry
M271_39495        CDS       T02907                                 

Definition
(GenBank) hypothetical protein
Organism
src  Streptomyces rapamycinicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGP59282
UniProt: A0A0A0NI84
LinkDB All DBs
Position
9650387..9651925
Genome map
AA seq 512 aa AA seqDB search
MSAVETAIGRKNRMSLAVRAEAPIGRTDRFFIGGQWVVPSSGAVIDVIDSATEELYFRVA
QAQAADMSRAVAAAREAFDEGPWPRLTAAERAGYLRAIGAELRLRGEDIAEIWPRESGVL
HTFAANAGTGAEAAFKRYAALARTFPFEEPVKPTAGGQFGMIVREPAGVVGAIIPWNAPM
GMISNKVGPALLAGCTVILKSAPEAPGEGYLLAEAAAAAGLPPGVINVVTADREVSELLV
RDRRVDKITFTGSTATGRRIASICGERVARCTLELGGKSAAVVLDDMDLATAARSLAQAE
CFLTGQVCSSLTRIVVSGSRHDELVEALVGVFSRVRVGDPFDPRSQMGPLAAGRQRDRVE
GYIAKGVAEGATLATGGGRPKGLTRGWYVEPTVFGNVDNRSVIAQEEIFGPVLSVIPAAD
EQDAIRIANDTIYGLNAAVFTNDVNRAREVSRQLRSGTVGHNALRSDLGIAFGGFKQSGI
GREGGREGLLPYLETKTVILEGRPAGYEDTVL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtcgagacggcgatcgggaggaagaaccggatgagcctggcggtacgcgcg
gaggcgccgatcggtcggacggaccgcttcttcatcggcgggcagtgggtggtgccgtcg
tccggcgccgtgatcgacgtgatcgactccgcgaccgaggagctctacttcagggtcgcg
caggcgcaggcagccgacatgtccagagccgtcgcggcggcgcgggaggccttcgacgaa
ggaccctggccgcgcctgacagcggccgagcgggccgggtacctgcgggcgatcggcgcg
gaactcaggctccgcggcgaggacatcgccgagatctggccgcgcgagtccggtgtcctg
cacaccttcgccgccaacgccggcaccggcgcggaggccgccttcaagcggtacgccgcg
ctggcccgcaccttcccgttcgaggagccggtcaagccgacggccggcggacagttcggc
atgatcgtccgtgagccggccggcgtggtcggtgcgatcatcccgtggaacgccccgatg
ggcatgatcagcaacaaggtcggccccgcgctgctcgccgggtgcaccgtgatcctgaag
tcggcgcccgaggcgccgggggagggctacctgctcgccgaggccgccgcggcggccggg
ctgccgcccggcgtgatcaacgtcgtcaccgcggaccgcgaggtgtccgaactgctggtg
cgcgaccggcgggtggacaagatcacgttcaccgggtcgacggccaccggacggcgcatc
gcctcgatctgcggcgagcgcgtggcccgctgcacgctggagctcggtggcaagtccgcc
gccgtcgtcctggacgacatggacctcgccacggccgcgcgcagcctcgcccaggccgag
tgcttcctcaccgggcaggtctgctcgtcgctgacccggatcgtggtcagcggctcgcgg
cacgacgaactggtcgaggccctcgtcggcgtgttctcccgggtgcgcgtcggggacccg
ttcgacccgcgctcgcagatggggccgctggcggccggccggcagcgggaccgggtcgag
gggtacatcgccaagggcgtcgcggaaggggccacgctggccaccggcggcggtcgcccg
aagggcctgacccgcggctggtacgtcgagcccaccgtgttcggcaacgtcgacaaccgc
tcggtcatcgcccaggaggagatcttcggccccgtgctgtccgtcatccccgcggccgac
gagcaggacgcgatccggatcgccaacgacaccatctacggcctcaacgcggcggtgttc
accaacgacgtcaaccgggcccgcgaggtttccaggcagctgcgctctggcaccgtcgga
cacaacgcgctgcgcagcgacctcggcatcgcgttcggcgggttcaagcagtccggcatc
ggccgcgaaggcggacgcgagggactgctgccctacctcgaaaccaagaccgtgatcctc
gaaggccggccggccgggtacgaggacaccgtcctctga

DBGET integrated database retrieval system