KEGG   Stenotrophomonas rhizophila: BAY15_2755Help
Entry
BAY15_2755        CDS       T04500                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
srh  Stenotrophomonas rhizophila
Brite
Enzymes [BR:srh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BAY15_2755
Peptidases [BR:srh01002]
 Metallo Peptidases
  Family M2
   BAY15_2755
Exosome [BR:srh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAY15_2755
CD molecules [BR:srh04090]
 Proteins
  BAY15_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3136918..3138891
Genome map
AA seq 657 aa AA seqDB search
MNHRPLLLALAVGAAALTLAACQKESSPTTAPAAGTTAPTETADQFIARVNAEYKALYPE
MTSAQWLSSTYINDDSERVAAKANERWLTILNGWIAQAGKYDGQPMSEDTKRQIHLLKLM
TAMPAPRDPAKLGELTRIASRMEGAYGSGKYCTDEANPATCRQLGDLEEVLASSRDYDKQ
LDAWQGWHGTTKPMRADYQRFVGLVNEGAKEMGFADAGQMWRSGYDMPPEQIGPETDRLW
EQVKPMYEQLHCYARTKLDGTYGKDKAETEGGLIAAHLLGNMWQQDWSNLWDQLEPYPGA
GSLDITAALEKQYQANLSGALAKAGGSNANVEALYKAQREAELRTAKQMTERAQDFYVSL
GMPALPKSYWDKTQFIKPLDRDVVCHASAWDMNMEGDVRTKMCIKPTEENFTTIYHELGH
IYYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPQYLNSIGLVDKPQESREATINAQM
RMALSGVSFLPFGLMIDRWRWGVFDGSITPDQYNKAWWDLKAKYQGVAPASARGEEFFDP
GAKYHVPGNTPYTRYFLARILQFQFYKGLCDAAGYKGPLHQCSFYGNKEAGQKFWAMLSK
GASQPWQATLKEITGGDKLDAGPMIEYFTPVNEWLKQQNQGQMCGWQPPAAAAPKAP
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaccgcccgctcctgctggccctggctgtcggtgctgccgcactgacgctggcg
gcctgccagaaggaatcgtcccccaccaccgcaccggccgcaggcaccaccgcgccgacc
gagaccgcggaccagttcatcgcccgcgtcaacgccgagtacaaggccctgtacccggaa
atgacctcggcgcagtggctgtcgtcgacctacatcaatgacgattccgagcgcgtggcg
gccaaggccaacgaacgctggctgaccatcctcaatggctggatcgcccaggccggcaag
tacgacggccagccgatgagcgaggacaccaagcgccagatccacctgctcaagctgatg
accgccatgccggccccgcgcgacccggccaagctgggcgagctgacccgcatcgccagc
cgcatggaaggcgcgtacggctcgggcaagtactgcaccgacgaggccaacccggccacc
tgccgccagctcggcgacctggaagaagtgctggccagcagccgcgactacgacaagcag
ctggacgcctggcagggctggcacggcaccaccaagccgatgcgcgccgattaccagcgc
ttcgtcggcctggtcaacgaaggcgccaaggaaatgggcttcgccgatgccgggcagatg
tggcgcagcggctacgacatgccgcccgagcagatcggcccggaaaccgaccgcctgtgg
gaacaggtcaaaccgatgtacgagcagctgcactgctacgcccgcaccaagctggacggc
acctacggcaaggacaaggccgaaaccgaaggcggcctgatcgccgcgcacctgctgggc
aacatgtggcagcaggactggtccaacctgtgggaccagcttgagccgtacccgggcgcg
ggcagcctggacatcaccgccgcgctggaaaagcagtaccaggcgaacctgagcggtgcg
ctggccaaggccggcggcagcaacgcgaacgtggaagcgctgtacaaggcgcagcgtgag
gccgaactgcgtaccgccaagcagatgaccgaacgcgcgcaggacttctacgtgtcgctg
ggcatgccggcgctgccgaagtcgtactgggacaagacccagttcatcaagccgctggac
cgtgacgtggtctgccacgccagcgcgtgggacatgaacatggaaggcgacgtgcgtacc
aagatgtgcatcaagccgaccgaagaaaacttcaccaccatctaccacgagctgggccac
atctattacgacctggcctacaacccgctgccgccgctgttccagggcggtgccaacgat
ggcttccacgaagcgatcggcgacaccatcgtgctggcgatgaccccgcagtacctgaac
tcgatcggcctggtcgacaagccgcaggaaagccgcgaggcgaccatcaacgcgcagatg
cgcatggccctgagcggcgtgtcgttcctgccgttcggcctgatgatcgaccgctggcgc
tggggcgtgttcgatggctcgatcaccccggaccagtacaacaaggcctggtgggacctg
aaggccaagtaccagggcgtggccccggcctcggcgcgcggcgaggagttcttcgatccg
ggcgccaagtaccacgtgccgggcaataccccgtacacgcgctacttcctggcgcgcatc
ctgcagttccagttctacaagggcctgtgcgacgcggccggctacaagggcccgctgcac
cagtgcagcttctacggcaacaaggaagccggccagaagttctgggcgatgctgagcaag
ggtgccagccagccgtggcaggccacgctgaaggaaatcaccggcggcgacaagctcgat
gccggcccgatgatcgagtacttcaccccggtcaacgagtggctgaagcagcagaaccag
ggccagatgtgcgggtggcagccgccggcggcggcggcgccgaaggccccgtaa

DBGET integrated database retrieval system