KEGG   Serratia plymuthica 4Rx13: SOD_c10350Help
Entry
SOD_c10350        CDS       T02710                                 

Gene name
mycA
Definition
(GenBank) mycosubtilin synthase subunit A
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1142042..1149880
Genome map
AA seq 2612 aa AA seqDB search
MPSHQLFNRGFNSFNQLLPELAVQHTDKTAFEFLRSAKEIKNQSYRQLHQRAASLACALQ
QYGHRGDRVILLYPDGEDFIGAFFGCLYAGMIAVPVPMPAKASGSAWERFIGVLRNAQTE
FIVTTGKGAETLISLGLPLSPLIFTFDQLPAVALPAGYRLQHLDSHFSGAFNPAPVSDDD
VAFLQYTSGSTGTPKGVMVTHGNLWANSQAIHRYFGHHNESRGMIWLPHFHDMGLIGGLL
QPVFGTFPCRVMSPMMLMKNPLNWLKQVSEFRATTSGGPNFAYDLCVRKISPQQAEGLDL
SNWDVAFCGAEPIRPATLRQFSEHFAPAGFRGQAFLPCYGMAETTLIVTGREKGQGMAVA
EEKAGDVVNCGEALPGTDVRIVDPETLQPLAAGHTGEIWLRGPSIAAGYWDNPAATEATF
QARIEPDPAHWLRSGDLGFLQAGALYVTGRVKELLIVNGQNHYPTDIEETIRGADILLAD
ATVCVFAAEVAETEQAVALLEIPERLKETLDTAALNRRLNAAVAERHGITLGEWVWVGRR
AIPRTTSGKLQRTRAREMYRQNELTVQWRSRAEPPQTAQVADVASYSAPALAALIAGIIG
IAVNGAVGEEQWDEAFTAFGLNSLQAVGVIGELEQHLGRELSPALIYDYPTINKLAAGLL
QPTERPEALATAVAGQDIAVIGIGVELPGHSGVQALWAMLQQGQSTTGEIPAHRWAGSAL
GGFNRKGSFFDRVSDFDAGYFGISPREAEYIDPQHRLLLETVQQALTDAGLQASALRGSD
TAVFIGISASDYALVSGNRVSAYSGLGNAHSIAANRISYLYDFKGPSVAIDTACSSSLVA
IDGAMQSLRSGRSSLAIAGGVNLALTPHLQKVFTEAQMLAPDGQCKTFDARADGYVRGEG
CGIVVLKPLAQALADGDRVYATLVASAINQDGRSNGITAPNGPSQQAVIARALAEAGIDS
NHIDYVEAHGTGTALGDLIEYQALEAVFAERSQPAPVQVGSIKTNIGHLEAAAGVLGVVK
TALMLHSQQRVPHLNFQQKNPHIAAISRRVAVAGSHPCAWESAAGQRYAGVSSFGFGGTN
SHVILRDCPQAVKRDEAAQPLTLLLVASHEEQGFNAQRDGIYSTLQMQHDVDVPAWCRLV
NTRYDHPRYRGFAHGANRRQLAENLAQLTANKAEKPRPQVWLFPGQGTQQIGMGAALYQH
LPHYRRCFDSLAERVQEEYQIDIRQALHAQDDSWQHCAKTCQLALFACSYATADCLLQFG
LRPTAVIGHSLGEYCAAVVAGQISLEQGLAMVHQRARLMGNLEQRGAMAVVFSGENEVRR
CIAPWADDIDIAAFNTPTLTTITGSSPAIDACLQAISAQGGHARRIKTSNAFHSHLMDPI
LPAYRLWLTQHIDFAEGNIPFYSNLDALPRRHTDADYWSQQIRQPVHFLQGIQALQEEGK
YTFVDLSADSSLGKFVAATDRSQPILAAVDHRHEYQSLLTLLGSLWQQGHDIDWSRLYRA
TSREALTLPAIQFCRKTYWLADETPTLPPSSHEDAMSKQHQLHAEIKAIIAGYLGASPEA
LDDDLPFLEMGADSLVLLDAINTIKDRYGVVIPLRSLFEELNTLDAVIHYVVERAQVPEP
VAVVSESRVVTAMPQADASVMPASAPQLEPEGGIPATAPAELQGVIARQLEVMSQQLRLL
SGGDAKPLSAPALPSAPASAPVAALPAPAVASNAPATAAQAKAGPHASWFKKETRKASLG
AERDKHIQQLTQQFVSKTPGSKHNAQQYRAVLADNRASAGFRLSTKEMLYPLVGVRSQGS
RIWDADGNEYIDFTMGFGANLLGHAPECVQQAVAAQLAQGMQIGPQSPLAGEVATLIAEL
TGQHRVAFCNSGSEAVMSAVRLARAVTGKNKVALFSGSYHGVFDGILGRQQGGETPERAV
PIAAGTTASLVEDLLVLDYGSEESLALIAQYADQLAAVIVEPIQSRYPDHQPRDYLHALR
KLTAERNIALMFDEVITGFRLAAGGAQAYYGVQADIATYGKIVGGGMPIGAIAGSARFMD
SIDGGFWQYGDESWPQSELIFFAGTFSKHPLTMAASKAVLDYIKSHPGLYDDINQKTHYL
AQTLNTWFVTTGTPIEIVSAGSLFRFKFSGNYDILFHHLMLRGIFIWEGRNCFVSTAHSS
QDIELFIAAVKESVKAMRVDGFFGDAGLHPDTPYPATDSQQRFMLLAAKDESGLCAGNVG
CVVETAREIEGSLLAEAWALLSERHDSLRMQFNDAGELRVASGVVNVDFIEERSESTDPA
ARLAAFAAKPFALTAAPLARVLLLSQPGQTALALTAHHTVADGWSFMVMLRELLHIYDAL
AAGFSPELSAAPSYLHFMRAEKTANDAEVAQRLAAIPARRFDPASALPVVLQAAPYHGQR
LKQGLAYPNLSAQLRKVAAELRTTRFVMLNALFVLTLEKFVGHSLLPVAVPNAGRDFENS
EGLVGQCVSLMPLCFNSAASASLPEFVAKVHQAILAQRDAPALPSRCFHGEQALLPLLAT
FNVEPSVPLAEMRQWQASLSMLPVNAVEFPLMINVVEMADELSIELDYQARYFTEQTASA
LLEPYLAAIAVLAEQGVSAVNQQFYSPVAVEA
NT seq 7839 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatcagttgtttaacaggggatttaattccttcaaccaactattgcccgag
cttgctgttcaacataccgacaagacggcatttgaatttttgcgaagtgccaaagaaata
aagaatcaaagttacagacaattgcatcagcgcgccgcatctctggcctgcgcacttcag
caatatggtcatcggggcgacagggttattttactttaccccgacggcgaagattttatt
ggcgcttttttcgggtgcctttatgccggcatgattgccgtgcctgtccctatgccggcc
aaggcctcaggcagcgcgtgggagcgctttattggggttttacgcaatgcgcaaacggaa
tttatcgttaccacaggcaaaggcgctgaaaccttaatatcgctcggtttaccgctgtca
ccgctaatttttacctttgatcaactgcccgcagtggcattgccggcggggtatcgcctt
cagcatctcgatagccacttttcaggggcgtttaatcctgcgccggtgagcgacgatgat
gtggcttttttgcaatacacctcgggttcaaccggtacgccaaaaggggtcatggtcact
catggcaacctgtgggccaactctcaagccatccatcgttatttcggtcaccacaatgaa
agccgcggcatgatatggctgccgcatttccatgatatggggctgatcggcggcttgctt
cagccggtattcgggacattcccctgccgggtgatgtcgccgatgatgctgatgaaaaac
ccgcttaactggttaaagcaggtgtcagagttccgtgcgacgacgtcgggcggccctaat
ttcgcctacgacctctgcgtgcgcaaaatcagccctcagcaggccgaaggcctggatctc
tccaactgggatgtggcgttttgcggtgcggagcctatccggccagctacgttgcgccag
ttcagtgaacactttgccccggccggtttccgggggcaggcgtttttaccctgctatggc
atggcggaaaccacgctgatcgttaccggcagggagaaaggccaggggatggcggtcgcc
gaagaaaaagcgggggatgtcgtcaactgtggcgaggcgttgcccggcaccgatgtccgc
attgtcgatcccgagacgctacaaccgctggcagccgggcacaccggcgagatctggttg
cgtgggcccagcattgcggccggttattgggataacccggcggcgacagaggccaccttc
caggcgcgcatcgagcctgatccggcgcattggctacgcagcggcgatttggggttcctg
caagcgggggcgctgtacgtcaccggacgtgtgaaagaacttttgatcgtcaatgggcaa
aaccattacccgacggatatcgaggaaacgatcaggggagcagatattttgctggcggac
gcaaccgtttgcgtctttgccgccgaggttgccgaaacggaacaggcggtggctttgctg
gagatcccggaacgtctcaaagagaccctggacaccgcagcgttgaaccggcgtttgaat
gccgcggtggccgagcggcacggcataaccctgggggaatgggtatgggtcggccgccgg
gccattccacgcaccaccagtggcaaattgcaacgtacccgcgccagagaaatgtaccgg
caaaatgaactgacggtgcaatggcgtagccgggccgagccgccgcaaaccgcccaggtt
gccgatgttgcctcatacagcgcgcctgccctggccgcgcttatcgccggtatcatcggc
attgcggtcaacggcgctgtcggtgaagaacagtgggatgaggcctttaccgcctttggg
ctgaactcgttacaggccgttggcgtgatcggcgagttagaacaacatttggggcgtgag
ctgtcgccggcgctgatttacgattatccgacgatcaataagctggctgcgggtctgttg
caacccactgagcgaccggaagcgcttgcgacggccgtggccggccaggatatcgccgtg
attggcatcggggttgaactgccaggccacagtggtgtgcaggcgctatgggcgatgttg
cagcaggggcaaagcaccacgggtgaaatccccgctcaccgttgggccggctctgcactc
ggcggttttaaccgcaagggcagtttctttgaccgcgtgagcgattttgacgccggttac
tttggcatttcgccgcgcgaggcggagtatatcgacccgcaacatcgcctgctgttggaa
accgtgcaacaggcgctgaccgatgcggggttacaggcttcggcgctgcggggcagcgac
accgcggtgtttatcggcatcagcgccagcgattatgccctggtctcgggcaaccgggtt
tccgcgtatagcgggttgggcaatgcgcacagcattgccgccaaccgcatatcttatctt
tatgattttaaagggccgagcgtcgccatcgataccgcctgttcctcttcgctggtggcc
atcgacggggccatgcaaagcctgcgctcaggacgcagttcgctggctattgccggcggc
gtgaatctggcgttgacgccgcatttgcaaaaggtcttcaccgaggcgcagatgttggca
ccggacggccagtgcaaaacctttgacgcgcgcgccgatggctatgtgcgtggcgagggg
tgcggcatcgttgttttgaaacccctggcgcaggcattggccgatggcgatcgggtttat
gccaccttggttgccagtgccatcaatcaggatggccgcagcaacggcatcacggcacct
aacgggccatcgcagcaggcggtgatcgcgcgggcgctggccgaggcgggcatcgacagc
aatcacatcgactatgtggaagcgcatggcaccgggacggcgctgggtgacctgatcgag
tatcaggcgctggaagcggtgtttgccgagcggagccaaccggcaccggttcaggtggga
tcgatcaagaccaatattggccatctcgaagccgcagccggcgtgcttggggtggtgaag
accgcgttgatgctgcatagccaacagcgcgtgcctcatttgaatttccagcagaaaaac
ccgcatatcgccgccattagccgccgggtggcggtggcgggcagtcacccttgcgcctgg
gagtctgcggcgggccaacgttatgccggtgtcagcagttttggcttcggcgggacgaac
agccacgtgatactgcgtgattgcccgcaggccgttaagcgcgatgaggcggcccagccg
ctgacgctgctgctggtggcctcgcacgaagagcagggtttcaacgcgcagcgtgacggc
atttatagcaccttgcaaatgcagcacgacgttgacgtcccggcatggtgtcgcctggtc
aatacccgttatgaccacccgcgctatcgtgggtttgcccatggcgccaaccgccggcaa
ttggcagaaaacctggcgcaactcaccgcgaataaagcggagaaaccgcgcccgcaggtc
tggctcttccctgggcagggaacgcagcaaatcggcatgggggcggctttataccagcat
ctgccgcactaccgcaggtgcttcgatagcctggctgagcgggttcaggaagagtatcaa
atcgatattcggcaagcgctgcatgcgcaggacgacagttggcagcattgcgccaaaacc
tgccagttggccctgtttgcctgcagctatgccacggcggactgcttgttgcagttcggg
ctacgcccgacggcggtgattggccatagcctgggcgagtattgcgctgcggttgtcgcc
ggccagatttcgctggagcaggggttggcgatggttcatcagcgcgcacgcctgatgggc
aacctggagcagcggggtgcgatggcggtggtgttcagcggcgaaaacgaggttcgccgc
tgtatcgccccttgggccgatgatatcgatattgccgcgttcaatacgccgacgctgacc
accatcaccggcagttcgccggcgattgacgcttgtctacaggcgatttcggcgcaaggt
ggccatgcccgccggatcaaaaccagcaacgcctttcattctcacctgatggatcccatc
ttgccggcgtatcgcctttggttgacgcagcatattgatttcgctgaggggaatatccct
ttctacagcaatctggacgctctgccgcgtcgacacaccgatgccgactactggagccaa
caaatccggcaacccgttcatttcctgcaaggcatacaggcgctgcaggaggaagggaaa
tatacctttgtggacctgagcgccgacagttcgctgggcaagttcgtcgccgccaccgat
cgcagccaaccgattttggcggccgtcgatcatcgccatgaataccaatcactgctgacg
ctgctgggttcgttgtggcagcaagggcatgacatcgactggtccaggctgtatcgcgca
acaagtcgtgaagcgttgacgctgccggccattcaattttgtcggaaaacttattggctg
gccgatgaaacgccaacgctgccgccatcttcacatgaggacgctatgtcaaaacaacat
caattacacgccgaaatcaaagcgatcattgccgggtatttgggggcatcgcccgaagct
ctggatgatgatctgcccttcctggaaatgggggccgactcgctggtcttgctggatgcg
atcaataccatcaaggatcgctatggcgtggtgatcccgctgagatcgctgtttgaagag
ttgaacacgctggatgcggtgatccattacgttgtggaacgtgcgcaagtgccggagccc
gtcgcggtggtcagtgaaagccgggttgtgacggcaatgccgcaagccgacgcttcggtg
atgcctgcgtcggcccctcagctcgaaccggaagggggaataccggcaacggccccggcc
gagttgcaaggtgtgattgcgcggcaattagaggtcatgtcgcaacagctgcgcctgtta
agcggcggcgatgctaaaccgctttccgcgcccgcgctgccttcggctccggcaagcgcg
ccggtagccgcacttcctgcaccggcagtggcgagtaatgcgcctgctaccgctgcacag
gccaaagccggcccgcacgctagctggtttaaaaaggaaaccaggaaggcgtcattaggg
gccgagcgcgataaacacatacagcaattgacgcagcagtttgtcagcaaaaccccgggg
tccaagcacaatgcgcagcagtaccgcgccgtgctggcggataaccgggcatcggcgggt
ttccgtttatccacgaaggaaatgctgtatcccctggtgggcgtgcgttcacaaggctcc
cgtatttgggatgccgacggtaacgagtacattgatttcaccatggggtttggcgccaac
ctgttgggccatgcacctgagtgcgtgcagcaggccgttgccgcacagctggcgcaaggc
atgcaaatcgggccgcagagcccgctggccggtgaggttgcaacattgattgcagagctg
acgggccagcaccgcgtggcgttttgtaactccggttctgaagccgtcatgagcgcggtg
cgtctggcgcgtgccgtaacgggcaagaacaaagtggcgctgttcagcggctcttatcac
ggcgttttcgatggcatcctggggcgtcagcaggggggcgaaaccccggagcgggcagtg
ccgattgccgcagggacgacggcgtccctggtcgaggatctgctggtgctcgactacggc
agcgaagagagtctggctttgattgcccagtatgccgatcaactggccgcggtcattgtg
gagccgattcaaagccgctatcccgatcatcagccgcgcgactatttgcatgcgctgcgt
aagctgacggccgagcgcaatatcgccttgatgttcgatgaagtgattaccggtttccgc
ctggctgccggcggtgcgcaggcgtattacggtgtccaggccgatatcgccacctacggc
aagattgtcggcggcggcatgccgattggcgctattgcggggtcggcgcgctttatggac
agcatcgacggcggtttctggcaatacggcgatgaatcctggccgcaatccgaactgatt
ttctttgccgggaccttctccaaacaccctctgaccatggcggccagcaaagcggtgctc
gactatatcaagagccaccccgggctctatgacgacatcaaccaaaagacgcattacctc
gcgcagacgctcaacacctggtttgtcacgacgggtacgccgatcgagatcgtctcggcg
ggcagtttgttccgtttcaaattcagcggtaactacgacattctgttccaccacctcatg
ctgcgcggcatctttatttgggagggccgcaactgcttcgtgtccaccgcgcactcttcg
caagatatagagctctttatcgcggcggtaaaagagagcgttaaggccatgcgcgttgac
ggtttcttcggtgatgccggtttgcaccccgatacgccttacccggccaccgacagccag
cagcgctttatgctgctggccgccaaagacgaaagcgggctgtgcgcgggcaacgttggc
tgcgtggttgaaacggcgcgtgaaatcgagggttcacttctggccgaagcctgggcgctg
ctgagcgaacgtcatgactctttgcgtatgcagttcaatgacgcgggggagttgcgggtg
gcgtcgggcgtggtcaatgtcgattttattgaggagcgcagtgagtccacggaccctgca
gcccgcctggccgcgtttgccgctaaacccttcgcattgacggcagcgccgctggcgcgc
gtcttgttgctgagccagcccggccaaacggccctggcgttgacggcgcaccatacggtg
gcagatggctggtcatttatggtgatgctgcgtgaactgctgcatatctacgatgcgctg
gcggcagggtttagccctgagctgtcggcggcgccgagctatttgcattttatgcgtgcg
gaaaagacggccaatgatgcagaggttgctcaacggctggccgctatccccgcgcgtcgt
ttcgatcccgccagcgcgctgccggttgtcctgcaggccgcgccgtatcacggccagcgt
ttgaagcaagggctggcttacccgaacttgtcggcccaactgcgtaaagtggccgccgag
ctgcgcacgactcgctttgtgatgttgaacgccctgtttgtactgacgctcgagaagttt
gtcggccactctctgttgcctgtcgctgtgccgaatgccgggcgtgacttcgagaacagc
gaagggttggtcggccaatgcgtcagcctgatgccgttgtgtttcaacagcgccgcgagc
gcttcgttgcctgagtttgtggccaaggtgcatcaggccattctggcgcagcgtgacgcg
ccggcattgccgtcccgctgtttccatggcgagcaagcgctgctgcctctgcttgccaca
ttcaatgttgagccgtccgttccgttggcggaaatgcgccagtggcaggccagcctgtcg
atgctgccggtcaacgcggtcgagttccccctgatgatcaacgtggtggaaatggccgat
gagctgtcgattgagctggattatcaggcgcgttatttcaccgagcaaaccgcctcagcg
ctgctggagccgtatctggctgcgattgcggttctggcagagcaaggcgtgagcgccgta
aatcagcagttttattcaccggttgccgtggaagcatga

DBGET integrated database retrieval system